Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 1449907..1450586 | Replicon | chromosome |
Accession | NZ_CP103609 | ||
Organism | Escherichia coli strain 4314 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XN95 |
Locus tag | M5S83_RS07045 | Protein ID | WP_000057540.1 |
Coordinates | 1449907..1450209 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | M5S83_RS07050 | Protein ID | WP_000806442.1 |
Coordinates | 1450245..1450586 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S83_RS07025 (1445170) | 1445170..1446390 | - | 1221 | WP_001251608.1 | fosmidomycin MFS transporter | - |
M5S83_RS07030 (1446608) | 1446608..1448260 | + | 1653 | WP_000771768.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
M5S83_RS07035 (1448297) | 1448297..1448776 | - | 480 | WP_000186631.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
M5S83_RS07040 (1448980) | 1448980..1449774 | - | 795 | WP_000365180.1 | TraB/GumN family protein | - |
M5S83_RS07045 (1449907) | 1449907..1450209 | + | 303 | WP_000057540.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5S83_RS07050 (1450245) | 1450245..1450586 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
M5S83_RS07055 (1450644) | 1450644..1453148 | - | 2505 | WP_023155691.1 | copper-exporting P-type ATPase CopA | - |
M5S83_RS07060 (1453410) | 1453410..1454342 | + | 933 | WP_023155692.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11781.35 Da Isoelectric Point: 10.2638
>T255797 WP_000057540.1 NZ_CP103609:1449907-1450209 [Escherichia coli]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTSLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTSLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|