Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 281004..281606 | Replicon | chromosome |
Accession | NZ_CP103609 | ||
Organism | Escherichia coli strain 4314 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | M5S83_RS01420 | Protein ID | WP_000897305.1 |
Coordinates | 281004..281315 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5S83_RS01425 | Protein ID | WP_000356397.1 |
Coordinates | 281316..281606 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S83_RS01390 (276034) | 276034..276819 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
M5S83_RS01395 (276918) | 276918..277517 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
M5S83_RS01400 (277511) | 277511..278383 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
M5S83_RS01405 (278380) | 278380..278817 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
M5S83_RS01410 (278862) | 278862..279803 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
M5S83_RS01415 (279867) | 279867..280775 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
M5S83_RS01420 (281004) | 281004..281315 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
M5S83_RS01425 (281316) | 281316..281606 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
M5S83_RS01430 (282192) | 282192..282410 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
M5S83_RS01435 (282629) | 282629..282871 | + | 243 | WP_001086388.1 | protein YiiF | - |
M5S83_RS01440 (283201) | 283201..284130 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
M5S83_RS01445 (284127) | 284127..284762 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5S83_RS01450 (284759) | 284759..285661 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T255791 WP_000897305.1 NZ_CP103609:281004-281315 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|