Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 740647..741422 | Replicon | chromosome |
Accession | NZ_CP103605 | ||
Organism | Klebsiella pneumoniae strain 4386 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A332L402 |
Locus tag | M5S85_RS03665 | Protein ID | WP_021314147.1 |
Coordinates | 740937..741422 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | M5S85_RS03660 | Protein ID | WP_004150912.1 |
Coordinates | 740647..740940 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S85_RS03640 (735855) | 735855..736457 | - | 603 | WP_021440720.1 | short chain dehydrogenase | - |
M5S85_RS03645 (736555) | 736555..737466 | + | 912 | WP_048290040.1 | LysR family transcriptional regulator | - |
M5S85_RS03650 (737467) | 737467..738615 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
M5S85_RS03655 (738626) | 738626..740002 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
M5S85_RS03660 (740647) | 740647..740940 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
M5S85_RS03665 (740937) | 740937..741422 | + | 486 | WP_021314147.1 | GNAT family N-acetyltransferase | Toxin |
M5S85_RS03670 (742126) | 742126..742719 | + | 594 | WP_004188553.1 | hypothetical protein | - |
M5S85_RS03675 (742816) | 742816..743032 | + | 217 | Protein_721 | transposase | - |
M5S85_RS03680 (743996) | 743996..744856 | + | 861 | WP_000158645.1 | DUF6387 family protein | - |
M5S85_RS03685 (745072) | 745072..745320 | + | 249 | WP_000616796.1 | AlpA family transcriptional regulator | - |
M5S85_RS03690 (745317) | 745317..745628 | + | 312 | WP_000837631.1 | hypothetical protein | - |
M5S85_RS03695 (745643) | 745643..746029 | + | 387 | WP_001545719.1 | hypothetical protein | - |
M5S85_RS03700 (746046) | 746046..746333 | + | 288 | WP_001291073.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 742816..742968 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17621.68 Da Isoelectric Point: 8.5144
>T255777 WP_021314147.1 NZ_CP103605:740937-741422 [Klebsiella pneumoniae]
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A332L402 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |