Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 356531..357117 Replicon chromosome
Accession NZ_CP103605
Organism Klebsiella pneumoniae strain 4386

Toxin (Protein)


Gene name doc Uniprot ID A0A331ME34
Locus tag M5S85_RS01670 Protein ID WP_025861226.1
Coordinates 356749..357117 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M5S85_RS01665 Protein ID WP_004174006.1
Coordinates 356531..356752 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S85_RS01645 (352687) 352687..353613 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M5S85_RS01650 (353610) 353610..354887 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M5S85_RS01655 (354884) 354884..355651 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M5S85_RS01660 (355653) 355653..356366 + 714 WP_085920978.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M5S85_RS01665 (356531) 356531..356752 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5S85_RS01670 (356749) 356749..357117 + 369 WP_025861226.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5S85_RS01675 (357390) 357390..358706 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M5S85_RS01680 (358813) 358813..359700 + 888 WP_014906831.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M5S85_RS01685 (359697) 359697..360542 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M5S85_RS01690 (360544) 360544..361614 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 353610..362351 8741


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13551.98 Da        Isoelectric Point: 8.6410

>T255775 WP_025861226.1 NZ_CP103605:356749-357117 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGIKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT255775 WP_004174006.1 NZ_CP103605:356531-356752 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331ME34

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References