Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 356531..357117 | Replicon | chromosome |
| Accession | NZ_CP103605 | ||
| Organism | Klebsiella pneumoniae strain 4386 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A331ME34 |
| Locus tag | M5S85_RS01670 | Protein ID | WP_025861226.1 |
| Coordinates | 356749..357117 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | M5S85_RS01665 | Protein ID | WP_004174006.1 |
| Coordinates | 356531..356752 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S85_RS01645 (352687) | 352687..353613 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| M5S85_RS01650 (353610) | 353610..354887 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| M5S85_RS01655 (354884) | 354884..355651 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| M5S85_RS01660 (355653) | 355653..356366 | + | 714 | WP_085920978.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| M5S85_RS01665 (356531) | 356531..356752 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M5S85_RS01670 (356749) | 356749..357117 | + | 369 | WP_025861226.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| M5S85_RS01675 (357390) | 357390..358706 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| M5S85_RS01680 (358813) | 358813..359700 | + | 888 | WP_014906831.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| M5S85_RS01685 (359697) | 359697..360542 | + | 846 | WP_004145129.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| M5S85_RS01690 (360544) | 360544..361614 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 353610..362351 | 8741 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13551.98 Da Isoelectric Point: 8.6410
>T255775 WP_025861226.1 NZ_CP103605:356749-357117 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGIKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGIKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A331ME34 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E5YJY7 |