Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3642249..3642943 | Replicon | chromosome |
Accession | NZ_CP103596 | ||
Organism | Escherichia coli strain 4848 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | M5T19_RS17770 | Protein ID | WP_001263489.1 |
Coordinates | 3642249..3642647 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | M5T19_RS17775 | Protein ID | WP_000554758.1 |
Coordinates | 3642650..3642943 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3637837) | 3637837..3637917 | - | 81 | NuclAT_11 | - | - |
- (3637837) | 3637837..3637917 | - | 81 | NuclAT_11 | - | - |
- (3637837) | 3637837..3637917 | - | 81 | NuclAT_11 | - | - |
- (3637837) | 3637837..3637917 | - | 81 | NuclAT_11 | - | - |
M5T19_RS17745 (3638513) | 3638513..3638971 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
M5T19_RS17750 (3639232) | 3639232..3640689 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
M5T19_RS17755 (3640746) | 3640746..3641267 | - | 522 | Protein_3471 | peptide chain release factor H | - |
M5T19_RS17760 (3641263) | 3641263..3641469 | - | 207 | Protein_3472 | RtcB family protein | - |
M5T19_RS17765 (3641787) | 3641787..3642239 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
M5T19_RS17770 (3642249) | 3642249..3642647 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
M5T19_RS17775 (3642650) | 3642650..3642943 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
M5T19_RS17780 (3642995) | 3642995..3644050 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
M5T19_RS17785 (3644121) | 3644121..3644906 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
M5T19_RS17790 (3644878) | 3644878..3646590 | + | 1713 | Protein_3478 | flagellar biosynthesis protein FlhA | - |
M5T19_RS17795 (3646814) | 3646814..3647311 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3642249..3657529 | 15280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T255766 WP_001263489.1 NZ_CP103596:c3642647-3642249 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |