Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 63331..63570 | Replicon | plasmid pMB7542_1 |
| Accession | NZ_CP103593 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4224 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | M5S53_RS25335 | Protein ID | WP_023144756.1 |
| Coordinates | 63436..63570 (+) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 63331..63391 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S53_RS25305 (59122) | 59122..59682 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| M5S53_RS25310 (59813) | 59813..60025 | + | 213 | WP_013023861.1 | hypothetical protein | - |
| M5S53_RS25315 (60584) | 60584..61009 | + | 426 | WP_000422741.1 | transposase | - |
| M5S53_RS25320 (61006) | 61006..61356 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M5S53_RS25325 (61387) | 61387..63000 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| M5S53_RS25330 (63078) | 63078..63364 | + | 287 | Protein_77 | DUF2726 domain-containing protein | - |
| - (63331) | 63331..63391 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (63331) | 63331..63391 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (63331) | 63331..63391 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (63331) | 63331..63391 | - | 61 | NuclAT_2 | - | Antitoxin |
| M5S53_RS25335 (63436) | 63436..63570 | + | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| M5S53_RS25340 (63888) | 63888..64121 | + | 234 | WP_214124381.1 | replication regulatory protein RepA | - |
| M5S53_RS25345 (64227) | 64227..64358 | + | 132 | Protein_80 | protein CopA/IncA | - |
| M5S53_RS25350 (64358) | 64358..64432 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| M5S53_RS25355 (64425) | 64425..65282 | + | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| M5S53_RS25360 (66222) | 66222..66875 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M5S53_RS25365 (66968) | 66968..67225 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M5S53_RS25370 (67158) | 67158..67559 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M5S53_RS25375 (67808) | 67808..68223 | + | 416 | Protein_86 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB | 1..138020 | 138020 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T255746 WP_023144756.1 NZ_CP103593:63436-63570 [Escherichia coli O25b:H4-ST131]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT255746 NZ_CP103593:c63391-63331 [Escherichia coli O25b:H4-ST131]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
