Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 36366..36608 | Replicon | plasmid pMB7542_1 |
| Accession | NZ_CP103593 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4224 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | M5S53_RS25175 | Protein ID | WP_001372321.1 |
| Coordinates | 36483..36608 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 36366..36406 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S53_RS25150 (31561) | 31561..33519 | + | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
| M5S53_RS25155 (33574) | 33574..34008 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| M5S53_RS25160 (34005) | 34005..34767 | + | 763 | Protein_43 | plasmid SOS inhibition protein A | - |
| - (34736) | 34736..34922 | + | 187 | NuclAT_0 | - | - |
| - (34736) | 34736..34922 | + | 187 | NuclAT_0 | - | - |
| - (34736) | 34736..34922 | + | 187 | NuclAT_0 | - | - |
| - (34736) | 34736..34922 | + | 187 | NuclAT_0 | - | - |
| M5S53_RS25165 (34970) | 34970..36339 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - (36366) | 36366..36406 | + | 41 | NuclAT_1 | - | Antitoxin |
| - (36366) | 36366..36406 | + | 41 | NuclAT_1 | - | Antitoxin |
| - (36366) | 36366..36406 | + | 41 | NuclAT_1 | - | Antitoxin |
| - (36366) | 36366..36406 | + | 41 | NuclAT_1 | - | Antitoxin |
| M5S53_RS25170 (36392) | 36392..36541 | + | 150 | Protein_45 | plasmid maintenance protein Mok | - |
| M5S53_RS25175 (36483) | 36483..36608 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M5S53_RS25180 (36828) | 36828..37058 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| M5S53_RS25185 (37056) | 37056..37229 | - | 174 | Protein_48 | hypothetical protein | - |
| M5S53_RS25190 (37299) | 37299..37505 | + | 207 | WP_000275859.1 | hypothetical protein | - |
| M5S53_RS25195 (37530) | 37530..37682 | + | 153 | WP_231527929.1 | hypothetical protein | - |
| M5S53_RS25200 (37719) | 37719..38423 | + | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
| M5S53_RS25205 (38369) | 38369..39034 | - | 666 | WP_259384720.1 | transglycosylase SLT domain-containing protein | - |
| M5S53_RS25210 (39374) | 39374..39757 | + | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| M5S53_RS25215 (39891) | 39891..40568 | + | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| M5S53_RS25220 (40656) | 40656..40883 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| M5S53_RS25225 (40917) | 40917..41279 | + | 363 | WP_000338606.1 | type IV conjugative transfer system pilin TraA | - |
| M5S53_RS25230 (41284) | 41284..41595 | + | 312 | WP_000012107.1 | type IV conjugative transfer system protein TraL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB | 1..138020 | 138020 | |
| - | inside | IScluster/Tn | - | - | 34970..42366 | 7396 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T255743 WP_001372321.1 NZ_CP103593:36483-36608 [Escherichia coli O25b:H4-ST131]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 41 bp
>AT255743 NZ_CP103593:36366-36406 [Escherichia coli O25b:H4-ST131]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|