Detailed information of TA system TA255743

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 36366..36608
• Replicon: plasmid pMB7542_1
• Accession: NZ_CP103593
• Organism: Escherichia coli O25b:H4-ST131 strain 4224

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M5S53_RS25175
• Protein ID: WP_001372321.1
• Coordinates: 36483..36608 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	36366..36406 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5S53_RS25150 (31561)	31561..33519	+	1959	WP_000117179.1	ParB/RepB/Spo0J family partition protein	-
M5S53_RS25155 (33574)	33574..34008	+	435	WP_000845940.1	conjugation system SOS inhibitor PsiB	-
M5S53_RS25160 (34005)	34005..34767	+	763	Protein_43	plasmid SOS inhibition protein A	-
- (34736)	34736..34922	+	187	NuclAT_0	-	-
- (34736)	34736..34922	+	187	NuclAT_0	-	-
- (34736)	34736..34922	+	187	NuclAT_0	-	-
- (34736)	34736..34922	+	187	NuclAT_0	-	-
M5S53_RS25165 (34970)	34970..36339	+	1370	WP_085947770.1	IS3-like element IS150 family transposase	-
- (36366)	36366..36406	+	41	NuclAT_1	-	Antitoxin
- (36366)	36366..36406	+	41	NuclAT_1	-	Antitoxin
- (36366)	36366..36406	+	41	NuclAT_1	-	Antitoxin
- (36366)	36366..36406	+	41	NuclAT_1	-	Antitoxin
M5S53_RS25170 (36392)	36392..36541	+	150	Protein_45	plasmid maintenance protein Mok	-
M5S53_RS25175 (36483)	36483..36608	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5S53_RS25180 (36828)	36828..37058	+	231	WP_001426396.1	hypothetical protein	-
M5S53_RS25185 (37056)	37056..37229	-	174	Protein_48	hypothetical protein	-
M5S53_RS25190 (37299)	37299..37505	+	207	WP_000275859.1	hypothetical protein	-
M5S53_RS25195 (37530)	37530..37682	+	153	WP_231527929.1	hypothetical protein	-
M5S53_RS25200 (37719)	37719..38423	+	705	WP_001067858.1	IS6-like element IS26 family transposase	-
M5S53_RS25205 (38369)	38369..39034	-	666	WP_259384720.1	transglycosylase SLT domain-containing protein	-
M5S53_RS25210 (39374)	39374..39757	+	384	WP_001151566.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M5S53_RS25215 (39891)	39891..40568	+	678	WP_001348626.1	PAS domain-containing protein	-
M5S53_RS25220 (40656)	40656..40883	+	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-
M5S53_RS25225 (40917)	40917..41279	+	363	WP_000338606.1	type IV conjugative transfer system pilin TraA	-
M5S53_RS25230 (41284)	41284..41595	+	312	WP_000012107.1	type IV conjugative transfer system protein TraL	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17	senB	1..138020	138020
	-	inside	IScluster/Tn	-	-	34970..42366	7396

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T255743 WP_001372321.1 NZ_CP103593:36483-36608 [Escherichia coli O25b:H4-ST131]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 41 bp

>AT255743 NZ_CP103593:36366-36406 [Escherichia coli O25b:H4-ST131]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin