Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4883667..4884269 | Replicon | chromosome |
| Accession | NZ_CP103592 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4224 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | M5S53_RS23930 | Protein ID | WP_000897302.1 |
| Coordinates | 4883958..4884269 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M5S53_RS23925 | Protein ID | WP_000356397.1 |
| Coordinates | 4883667..4883957 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S53_RS23895 (4878974) | 4878974..4879903 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
| M5S53_RS23900 (4880085) | 4880085..4880327 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| M5S53_RS23905 (4880617) | 4880617..4881465 | + | 849 | WP_001038650.1 | hypothetical protein | - |
| M5S53_RS23910 (4881490) | 4881490..4882230 | + | 741 | WP_000608806.1 | hypothetical protein | - |
| M5S53_RS23915 (4882415) | 4882415..4882633 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| M5S53_RS23920 (4883030) | 4883030..4883308 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| M5S53_RS23925 (4883667) | 4883667..4883957 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| M5S53_RS23930 (4883958) | 4883958..4884269 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| M5S53_RS23935 (4884498) | 4884498..4885406 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| M5S53_RS23940 (4885470) | 4885470..4886411 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| M5S53_RS23945 (4886456) | 4886456..4886893 | - | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| M5S53_RS23950 (4886890) | 4886890..4887762 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| M5S53_RS23955 (4887756) | 4887756..4888355 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T255742 WP_000897302.1 NZ_CP103592:c4884269-4883958 [Escherichia coli O25b:H4-ST131]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|