Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3679519..3680198 | Replicon | chromosome |
| Accession | NZ_CP103592 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4224 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | M5S53_RS18250 | Protein ID | WP_000057523.1 |
| Coordinates | 3679896..3680198 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | M5S53_RS18245 | Protein ID | WP_000806442.1 |
| Coordinates | 3679519..3679860 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S53_RS18235 (3675763) | 3675763..3676695 | - | 933 | WP_000883041.1 | glutaminase A | - |
| M5S53_RS18240 (3676957) | 3676957..3679461 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| M5S53_RS18245 (3679519) | 3679519..3679860 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| M5S53_RS18250 (3679896) | 3679896..3680198 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5S53_RS18255 (3680331) | 3680331..3681125 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| M5S53_RS18260 (3681329) | 3681329..3681808 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| M5S53_RS18265 (3681832) | 3681832..3682632 | + | 801 | WP_000439798.1 | hypothetical protein | - |
| M5S53_RS18270 (3682629) | 3682629..3683132 | + | 504 | WP_000667000.1 | hypothetical protein | - |
| M5S53_RS18275 (3683170) | 3683170..3684822 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T255734 WP_000057523.1 NZ_CP103592:c3680198-3679896 [Escherichia coli O25b:H4-ST131]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT255734 WP_000806442.1 NZ_CP103592:c3679860-3679519 [Escherichia coli O25b:H4-ST131]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|