Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
Location | 1933363..1933865 | Replicon | chromosome |
Accession | NZ_CP103592 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 4224 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | E2QNP2 |
Locus tag | M5S53_RS09165 | Protein ID | WP_000767819.1 |
Coordinates | 1933611..1933865 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | E2QNP3 |
Locus tag | M5S53_RS09160 | Protein ID | WP_001259253.1 |
Coordinates | 1933363..1933614 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S53_RS09135 (1928541) | 1928541..1929608 | - | 1068 | WP_000080057.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
M5S53_RS09140 (1929608) | 1929608..1930678 | - | 1071 | WP_000108967.1 | histidinol-phosphate transaminase | - |
M5S53_RS09145 (1930675) | 1930675..1931979 | - | 1305 | WP_001296211.1 | histidinol dehydrogenase | - |
M5S53_RS09150 (1931985) | 1931985..1932884 | - | 900 | WP_000131782.1 | ATP phosphoribosyltransferase | - |
M5S53_RS09155 (1933030) | 1933030..1933080 | - | 51 | WP_001364200.1 | his operon leader peptide | - |
M5S53_RS09160 (1933363) | 1933363..1933614 | + | 252 | WP_001259253.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
M5S53_RS09165 (1933611) | 1933611..1933865 | + | 255 | WP_000767819.1 | type II toxin-antitoxin system mRNA interferase toxin YoeB | Toxin |
M5S53_RS09170 (1933948) | 1933948..1934772 | + | 825 | WP_000754737.1 | SDR family oxidoreductase | - |
M5S53_RS09175 (1934818) | 1934818..1935747 | + | 930 | WP_000803366.1 | LysR substrate-binding domain-containing protein | - |
M5S53_RS09180 (1935962) | 1935962..1936024 | + | 63 | WP_010723108.1 | membrane protein YoeI | - |
M5S53_RS09185 (1936014) | 1936014..1937372 | + | 1359 | WP_000019194.1 | putrescine/proton symporter PlaP | - |
M5S53_RS09190 (1937589) | 1937589..1938047 | + | 459 | WP_001531805.1 | IS200/IS605-like element IS200C family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1937589..1938047 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10110.53 Da Isoelectric Point: 7.2749
>T255727 WP_000767819.1 NZ_CP103592:1933611-1933865 [Escherichia coli O25b:H4-ST131]
VKLIWSEESWDDYLYWQEADKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHLLVYAVTDDSLLIAAC
RYHY
VKLIWSEESWDDYLYWQEADKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHLLVYAVTDDSLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|