Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 26705..26969 Replicon plasmid pMB7603_1
Accession NZ_CP103590
Organism Escherichia coli strain 4750

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag M5T00_RS25405 Protein ID WP_001387489.1
Coordinates 26817..26969 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 26705..26765 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T00_RS25390 (22807) 22807..23877 - 1071 WP_012783932.1 IncI1-type conjugal transfer protein TrbB -
M5T00_RS25395 (23896) 23896..25104 - 1209 WP_001703845.1 IncI1-type conjugal transfer protein TrbA -
- (25284) 25284..25341 - 58 NuclAT_1 - -
- (25284) 25284..25341 - 58 NuclAT_1 - -
- (25284) 25284..25341 - 58 NuclAT_1 - -
- (25284) 25284..25341 - 58 NuclAT_1 - -
M5T00_RS25400 (25411) 25411..26496 - 1086 WP_000080543.1 protein finQ -
- (26705) 26705..26765 - 61 NuclAT_0 - Antitoxin
- (26705) 26705..26765 - 61 NuclAT_0 - Antitoxin
- (26705) 26705..26765 - 61 NuclAT_0 - Antitoxin
- (26705) 26705..26765 - 61 NuclAT_0 - Antitoxin
M5T00_RS25405 (26817) 26817..26969 + 153 WP_001387489.1 Hok/Gef family protein Toxin
M5T00_RS25410 (27041) 27041..27292 - 252 WP_001291964.1 hypothetical protein -
M5T00_RS25415 (27592) 27592..27888 + 297 WP_011264046.1 DinQ-like type I toxin DqlB -
M5T00_RS25420 (27953) 27953..28129 - 177 WP_001054900.1 hypothetical protein -
M5T00_RS25425 (28521) 28521..28730 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
M5T00_RS25430 (28802) 28802..29464 - 663 WP_012783935.1 plasmid IncI1-type surface exclusion protein ExcA -
M5T00_RS25435 (29535) 29535..31703 - 2169 WP_015508354.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-15 / blaTEM-1B - 1..91107 91107


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T255716 WP_001387489.1 NZ_CP103590:26817-26969 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT255716 NZ_CP103590:c26765-26705 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References