Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 26705..26969 | Replicon | plasmid pMB7603_1 |
| Accession | NZ_CP103590 | ||
| Organism | Escherichia coli strain 4750 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | M5T00_RS25405 | Protein ID | WP_001387489.1 |
| Coordinates | 26817..26969 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 26705..26765 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T00_RS25390 (22807) | 22807..23877 | - | 1071 | WP_012783932.1 | IncI1-type conjugal transfer protein TrbB | - |
| M5T00_RS25395 (23896) | 23896..25104 | - | 1209 | WP_001703845.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (25284) | 25284..25341 | - | 58 | NuclAT_1 | - | - |
| - (25284) | 25284..25341 | - | 58 | NuclAT_1 | - | - |
| - (25284) | 25284..25341 | - | 58 | NuclAT_1 | - | - |
| - (25284) | 25284..25341 | - | 58 | NuclAT_1 | - | - |
| M5T00_RS25400 (25411) | 25411..26496 | - | 1086 | WP_000080543.1 | protein finQ | - |
| - (26705) | 26705..26765 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (26705) | 26705..26765 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (26705) | 26705..26765 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (26705) | 26705..26765 | - | 61 | NuclAT_0 | - | Antitoxin |
| M5T00_RS25405 (26817) | 26817..26969 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| M5T00_RS25410 (27041) | 27041..27292 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| M5T00_RS25415 (27592) | 27592..27888 | + | 297 | WP_011264046.1 | DinQ-like type I toxin DqlB | - |
| M5T00_RS25420 (27953) | 27953..28129 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| M5T00_RS25425 (28521) | 28521..28730 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| M5T00_RS25430 (28802) | 28802..29464 | - | 663 | WP_012783935.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| M5T00_RS25435 (29535) | 29535..31703 | - | 2169 | WP_015508354.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-15 / blaTEM-1B | - | 1..91107 | 91107 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T255716 WP_001387489.1 NZ_CP103590:26817-26969 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT255716 NZ_CP103590:c26765-26705 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|