Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-timR/SymE(toxin) |
| Location | 4339080..4339492 | Replicon | chromosome |
| Accession | NZ_CP103589 | ||
| Organism | Escherichia coli strain 4750 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | S1NWQ7 |
| Locus tag | M5T00_RS21065 | Protein ID | WP_000132614.1 |
| Coordinates | 4339151..4339492 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | timR | ||
| Locus tag | - | ||
| Coordinates | 4339080..4339156 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T00_RS21055 (4335692) | 4335692..4337161 | + | 1470 | WP_001387312.1 | type I restriction-modification system subunit M | - |
| M5T00_RS21060 (4337161) | 4337161..4338930 | + | 1770 | WP_001513535.1 | restriction endonuclease subunit S | - |
| - (4339080) | 4339080..4339156 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4339080) | 4339080..4339156 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4339080) | 4339080..4339156 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4339080) | 4339080..4339156 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4339080) | 4339080..4339156 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (4339080) | 4339080..4339156 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (4339080) | 4339080..4339156 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (4339080) | 4339080..4339156 | - | 77 | NuclAT_9 | - | Antitoxin |
| M5T00_RS21065 (4339151) | 4339151..4339492 | + | 342 | WP_000132614.1 | endoribonuclease SymE | Toxin |
| M5T00_RS21070 (4339539) | 4339539..4340702 | - | 1164 | WP_224153787.1 | DUF1524 domain-containing protein | - |
| M5T00_RS21075 (4340756) | 4340756..4341632 | - | 877 | Protein_4127 | DUF262 domain-containing protein | - |
| M5T00_RS21080 (4342038) | 4342038..4342958 | - | 921 | WP_001513532.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| M5T00_RS21085 (4343143) | 4343143..4344423 | + | 1281 | WP_001338077.1 | DUF445 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | cheD | 4323468..4339492 | 16024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12266.07 Da Isoelectric Point: 8.4982
>T255709 WP_000132614.1 NZ_CP103589:4339151-4339492 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT255709 NZ_CP103589:c4339156-4339080 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|