Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3947596..3948290 | Replicon | chromosome |
| Accession | NZ_CP103589 | ||
| Organism | Escherichia coli strain 4750 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | M5T00_RS19190 | Protein ID | WP_001263500.1 |
| Coordinates | 3947596..3947994 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | M5T00_RS19195 | Protein ID | WP_000554758.1 |
| Coordinates | 3947997..3948290 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T00_RS19165 (3942961) | 3942961..3943419 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
| M5T00_RS19170 (3943680) | 3943680..3945137 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| M5T00_RS19175 (3945194) | 3945194..3945808 | - | 615 | WP_000602124.1 | peptide chain release factor H | - |
| M5T00_RS19180 (3945805) | 3945805..3946944 | - | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
| M5T00_RS19185 (3947134) | 3947134..3947586 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
| M5T00_RS19190 (3947596) | 3947596..3947994 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| M5T00_RS19195 (3947997) | 3947997..3948290 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| M5T00_RS19200 (3948342) | 3948342..3949397 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| M5T00_RS19205 (3949468) | 3949468..3950391 | - | 924 | WP_001532973.1 | putative lateral flagellar export/assembly protein LafU | - |
| M5T00_RS19210 (3950394) | 3950394..3951257 | - | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
| M5T00_RS19215 (3951270) | 3951270..3951986 | - | 717 | WP_000938731.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| M5T00_RS19220 (3952006) | 3952006..3952473 | - | 468 | WP_000725261.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T255706 WP_001263500.1 NZ_CP103589:c3947994-3947596 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|