Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3708969..3709648 | Replicon | chromosome |
Accession | NZ_CP103589 | ||
Organism | Escherichia coli strain 4750 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | M5T00_RS18095 | Protein ID | WP_000057523.1 |
Coordinates | 3709346..3709648 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | M5T00_RS18090 | Protein ID | WP_000806442.1 |
Coordinates | 3708969..3709310 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T00_RS18080 (3705213) | 3705213..3706145 | - | 933 | WP_001538399.1 | glutaminase A | - |
M5T00_RS18085 (3706407) | 3706407..3708911 | + | 2505 | WP_000083948.1 | copper-exporting P-type ATPase CopA | - |
M5T00_RS18090 (3708969) | 3708969..3709310 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
M5T00_RS18095 (3709346) | 3709346..3709648 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5T00_RS18100 (3709781) | 3709781..3710575 | + | 795 | WP_001538398.1 | TraB/GumN family protein | - |
M5T00_RS18105 (3710779) | 3710779..3711258 | + | 480 | WP_001538397.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
M5T00_RS18110 (3711295) | 3711295..3712947 | - | 1653 | WP_001773867.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
M5T00_RS18115 (3713165) | 3713165..3714385 | + | 1221 | WP_001773866.1 | fosmidomycin MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T255704 WP_000057523.1 NZ_CP103589:c3709648-3709346 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|