Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 748408..749101 | Replicon | chromosome |
Accession | NZ_CP103589 | ||
Organism | Escherichia coli strain 4750 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | M5T00_RS03660 | Protein ID | WP_000415584.1 |
Coordinates | 748408..748704 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | M5T00_RS03665 | Protein ID | WP_000650107.1 |
Coordinates | 748706..749101 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T00_RS03625 (743496) | 743496..743810 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
M5T00_RS03630 (743841) | 743841..744422 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
M5T00_RS03635 (744741) | 744741..745073 | + | 333 | WP_000917685.1 | DUF2645 family protein | - |
M5T00_RS03640 (745119) | 745119..746468 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
M5T00_RS03645 (746465) | 746465..747124 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
M5T00_RS03650 (747276) | 747276..747668 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
M5T00_RS03655 (747721) | 747721..748203 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
M5T00_RS03660 (748408) | 748408..748704 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
M5T00_RS03665 (748706) | 748706..749101 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
M5T00_RS03670 (749234) | 749234..750841 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
M5T00_RS03675 (750979) | 750979..753237 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T255695 WP_000415584.1 NZ_CP103589:748408-748704 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT255695 WP_000650107.1 NZ_CP103589:748706-749101 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|