Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 352874..353520 | Replicon | chromosome |
Accession | NZ_CP103582 | ||
Organism | Klebsiella pneumoniae strain 1498 |
Toxin (Protein)
Gene name | higB | Uniprot ID | W9BBY1 |
Locus tag | M5S97_RS01635 | Protein ID | WP_016529833.1 |
Coordinates | 352874..353221 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5S97_RS01640 | Protein ID | WP_141408257.1 |
Coordinates | 353221..353520 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S97_RS01625 (M5S97_01625) | 348800..350233 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
M5S97_RS01630 (M5S97_01630) | 350251..352698 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
M5S97_RS01635 (M5S97_01635) | 352874..353221 | + | 348 | WP_016529833.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5S97_RS01640 (M5S97_01640) | 353221..353520 | + | 300 | WP_141408257.1 | XRE family transcriptional regulator | Antitoxin |
M5S97_RS01645 (M5S97_01645) | 353583..355091 | - | 1509 | WP_029602548.1 | glycerol-3-phosphate dehydrogenase | - |
M5S97_RS01650 (M5S97_01650) | 355296..355625 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
M5S97_RS01655 (M5S97_01655) | 355676..356506 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
M5S97_RS01660 (M5S97_01660) | 356556..357314 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13549.56 Da Isoelectric Point: 5.6749
>T255660 WP_016529833.1 NZ_CP103582:352874-353221 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|