Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 326686..327272 | Replicon | chromosome |
Accession | NZ_CP103582 | ||
Organism | Klebsiella pneumoniae strain 1498 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | M5S97_RS01525 | Protein ID | WP_023285605.1 |
Coordinates | 326904..327272 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | W9B1V1 |
Locus tag | M5S97_RS01520 | Protein ID | WP_004174006.1 |
Coordinates | 326686..326907 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S97_RS01500 (M5S97_01500) | 322843..323769 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
M5S97_RS01505 (M5S97_01505) | 323766..325043 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
M5S97_RS01510 (M5S97_01510) | 325040..325807 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
M5S97_RS01515 (M5S97_01515) | 325809..326522 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
M5S97_RS01520 (M5S97_01520) | 326686..326907 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M5S97_RS01525 (M5S97_01525) | 326904..327272 | + | 369 | WP_023285605.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
M5S97_RS01530 (M5S97_01530) | 327545..328861 | + | 1317 | WP_002920796.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
M5S97_RS01535 (M5S97_01535) | 328968..329855 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
M5S97_RS01540 (M5S97_01540) | 329852..330697 | + | 846 | WP_004145129.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
M5S97_RS01545 (M5S97_01545) | 330699..331769 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 323766..332506 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13534.89 Da Isoelectric Point: 8.6410
>T255659 WP_023285605.1 NZ_CP103582:326904-327272 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|