Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 751066..751841 | Replicon | chromosome |
| Accession | NZ_CP103579 | ||
| Organism | Klebsiella pneumoniae strain 4014 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | M5S61_RS03765 | Protein ID | WP_060568463.1 |
| Coordinates | 751356..751841 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | M5S61_RS03760 | Protein ID | WP_004150912.1 |
| Coordinates | 751066..751359 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S61_RS03740 (746274) | 746274..746876 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
| M5S61_RS03745 (746974) | 746974..747885 | + | 912 | WP_023342207.1 | LysR family transcriptional regulator | - |
| M5S61_RS03750 (747886) | 747886..749034 | - | 1149 | WP_016947441.1 | PLP-dependent aspartate aminotransferase family protein | - |
| M5S61_RS03755 (749045) | 749045..750421 | - | 1377 | WP_004174417.1 | pyridoxal-phosphate dependent enzyme | - |
| M5S61_RS03760 (751066) | 751066..751359 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| M5S61_RS03765 (751356) | 751356..751841 | + | 486 | WP_060568463.1 | GNAT family N-acetyltransferase | Toxin |
| M5S61_RS03770 (752545) | 752545..753138 | + | 594 | WP_004188553.1 | hypothetical protein | - |
| M5S61_RS03775 (753235) | 753235..753451 | + | 217 | Protein_741 | transposase | - |
| M5S61_RS03785 (754292) | 754292..755005 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 753235..753387 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17602.64 Da Isoelectric Point: 8.1629
>T255646 WP_060568463.1 NZ_CP103579:751356-751841 [Klebsiella pneumoniae]
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRHNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRHNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|