Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3624476..3625170 | Replicon | chromosome |
| Accession | NZ_CP103570 | ||
| Organism | Escherichia coli strain 3045 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | M5S79_RS17470 | Protein ID | WP_001263489.1 |
| Coordinates | 3624476..3624874 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | M5S79_RS17475 | Protein ID | WP_000554758.1 |
| Coordinates | 3624877..3625170 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3620064) | 3620064..3620144 | - | 81 | NuclAT_11 | - | - |
| - (3620064) | 3620064..3620144 | - | 81 | NuclAT_11 | - | - |
| - (3620064) | 3620064..3620144 | - | 81 | NuclAT_11 | - | - |
| - (3620064) | 3620064..3620144 | - | 81 | NuclAT_11 | - | - |
| M5S79_RS17445 (3620740) | 3620740..3621198 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| M5S79_RS17450 (3621459) | 3621459..3622916 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| M5S79_RS17455 (3622973) | 3622973..3623494 | - | 522 | Protein_3413 | peptide chain release factor H | - |
| M5S79_RS17460 (3623490) | 3623490..3623696 | - | 207 | Protein_3414 | RtcB family protein | - |
| M5S79_RS17465 (3624014) | 3624014..3624466 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| M5S79_RS17470 (3624476) | 3624476..3624874 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| M5S79_RS17475 (3624877) | 3624877..3625170 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| M5S79_RS17480 (3625222) | 3625222..3626277 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| M5S79_RS17485 (3626348) | 3626348..3627133 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| M5S79_RS17490 (3627105) | 3627105..3628817 | + | 1713 | Protein_3420 | flagellar biosynthesis protein FlhA | - |
| M5S79_RS17495 (3629041) | 3629041..3629538 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 3624476..3639756 | 15280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T255619 WP_001263489.1 NZ_CP103570:c3624874-3624476 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |