Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 451398..451984 Replicon chromosome
Accession NZ_CP103567
Organism Klebsiella pneumoniae strain 4680

Toxin (Protein)


Gene name doc Uniprot ID A0A331ME34
Locus tag M5S58_RS02170 Protein ID WP_025861226.1
Coordinates 451616..451984 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M5S58_RS02165 Protein ID WP_004174006.1
Coordinates 451398..451619 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S58_RS02145 (447554) 447554..448480 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M5S58_RS02150 (448477) 448477..449754 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M5S58_RS02155 (449751) 449751..450518 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M5S58_RS02160 (450520) 450520..451233 + 714 WP_085920978.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M5S58_RS02165 (451398) 451398..451619 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5S58_RS02170 (451616) 451616..451984 + 369 WP_025861226.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5S58_RS02175 (452257) 452257..453573 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M5S58_RS02180 (453680) 453680..454567 + 888 WP_014906831.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M5S58_RS02185 (454564) 454564..455409 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M5S58_RS02190 (455411) 455411..456481 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 448477..457218 8741


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13551.98 Da        Isoelectric Point: 8.6410

>T255592 WP_025861226.1 NZ_CP103567:451616-451984 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGIKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT255592 WP_004174006.1 NZ_CP103567:451398-451619 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331ME34

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References