Detailed information of TA system TA255584

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 138524..138950
• Replicon: plasmid pMB8236_1
• Accession: NZ_CP103563
• Organism: Escherichia coli O25b:H4-ST131 strain 751

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M5R24_RS26425
• Protein ID: WP_001372321.1
• Coordinates: 138524..138649 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	138726..138950 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5R24_RS26380 (133635)	133635..133862	-	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-
M5R24_RS26385 (133950)	133950..134627	-	678	WP_001348626.1	PAS domain-containing protein	-
M5R24_RS26390 (134761)	134761..135144	-	384	WP_001151566.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M5R24_RS26395 (135475)	135475..136077	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
M5R24_RS26400 (136374)	136374..137195	-	822	WP_001234469.1	DUF932 domain-containing protein	-
M5R24_RS26405 (137315)	137315..137602	-	288	WP_000107535.1	hypothetical protein	-
M5R24_RS26410 (137627)	137627..137833	-	207	WP_000547968.1	hypothetical protein	-
M5R24_RS26415 (137903)	137903..138076	+	174	Protein_162	hypothetical protein	-
M5R24_RS26420 (138074)	138074..138304	-	231	WP_001426396.1	hypothetical protein	-
M5R24_RS26425 (138524)	138524..138649	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5R24_RS26430 (138591)	138591..138740	-	150	Protein_165	plasmid maintenance protein Mok	-
- (138726)	138726..138950	-	225	NuclAT_0	-	Antitoxin
- (138726)	138726..138950	-	225	NuclAT_0	-	Antitoxin
- (138726)	138726..138950	-	225	NuclAT_0	-	Antitoxin
- (138726)	138726..138950	-	225	NuclAT_0	-	Antitoxin
M5R24_RS26435 (138762)	138762..138950	+	189	WP_001299721.1	hypothetical protein	-
M5R24_RS26440 (138919)	138919..139681	-	763	Protein_167	plasmid SOS inhibition protein A	-
M5R24_RS26445 (139678)	139678..140112	-	435	WP_001567348.1	conjugation system SOS inhibitor PsiB	-
M5R24_RS26450 (140167)	140167..142125	-	1959	WP_259430623.1	ParB/RepB/Spo0J family partition protein	-
M5R24_RS26455 (142191)	142191..142424	-	234	WP_000005990.1	DUF905 family protein	-
M5R24_RS26460 (142487)	142487..143026	-	540	WP_000290841.1	single-stranded DNA-binding protein	-
M5R24_RS26465 (143052)	143052..143258	-	207	WP_000275853.1	hypothetical protein	-
M5R24_RS26470 (143171)	143171..143506	-	336	WP_014106969.1	hypothetical protein	-
M5R24_RS26475 (143499)	143499..143762	-	264	WP_259430624.1	hypothetical protein	-
M5R24_RS26480 (143669)	143669..143887	-	219	WP_259430625.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aac(3)-IIa / blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / tet(A) / blaTEM-1B / mph(A) / sul1 / qacE / aadA2 / dfrA12 / sul2	senB / hlyD / hlyB / hlyA / hlyA / hlyC	1..241084	241084

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T255584 WP_001372321.1 NZ_CP103563:c138649-138524 [Escherichia coli O25b:H4-ST131]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT255584 NZ_CP103563:c138950-138726 [Escherichia coli O25b:H4-ST131]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin