Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 97991..98245 Replicon plasmid pMB8236_1
Accession NZ_CP103563
Organism Escherichia coli O25b:H4-ST131 strain 751

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag M5R24_RS26180 Protein ID WP_001312851.1
Coordinates 97991..98140 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 98184..98245 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R24_RS26150 (93238) 93238..94149 - 912 WP_000440183.1 carbamate kinase -
M5R24_RS26155 (94160) 94160..95380 - 1221 WP_000410951.1 arginine deiminase -
M5R24_RS26160 (96087) 96087..96701 + 615 Protein_111 VENN motif pre-toxin domain-containing protein -
M5R24_RS26165 (96701) 96701..97147 - 447 Protein_112 plasmid replication initiator RepA -
M5R24_RS26170 (97140) 97140..97214 - 75 WP_032336874.1 RepA leader peptide Tap -
M5R24_RS26175 (97450) 97450..97707 - 258 WP_000083833.1 replication regulatory protein RepA -
M5R24_RS26180 (97991) 97991..98140 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (98184) 98184..98245 + 62 NuclAT_1 - Antitoxin
- (98184) 98184..98245 + 62 NuclAT_1 - Antitoxin
- (98184) 98184..98245 + 62 NuclAT_1 - Antitoxin
- (98184) 98184..98245 + 62 NuclAT_1 - Antitoxin
M5R24_RS26185 (98384) 98384..98566 - 183 WP_000968309.1 hypothetical protein -
M5R24_RS26190 (98667) 98667..99283 + 617 Protein_117 IS1-like element IS1A family transposase -
M5R24_RS26195 (99321) 99321..100892 - 1572 WP_023149734.1 IS66-like element ISCro1 family transposase -
M5R24_RS26200 (100912) 100912..101259 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
M5R24_RS26205 (101259) 101259..101936 - 678 WP_001339397.1 IS66-like element accessory protein TnpA -
M5R24_RS26210 (101991) 101991..102080 + 90 Protein_121 IS1 family transposase -
M5R24_RS26215 (102381) 102381..102593 - 213 WP_005012601.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(3)-IIa / blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / tet(A) / blaTEM-1B / mph(A) / sul1 / qacE / aadA2 / dfrA12 / sul2 senB / hlyD / hlyB / hlyA / hlyA / hlyC 1..241084 241084


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T255580 WP_001312851.1 NZ_CP103563:c98140-97991 [Escherichia coli O25b:H4-ST131]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T255580 NZ_CP103563:c98140-97991 [Escherichia coli O25b:H4-ST131]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT255580 NZ_CP103563:98184-98245 [Escherichia coli O25b:H4-ST131]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References