Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 5001669..5002271 | Replicon | chromosome |
| Accession | NZ_CP103562 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 751 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | M5R24_RS24590 | Protein ID | WP_000897302.1 |
| Coordinates | 5001960..5002271 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M5R24_RS24585 | Protein ID | WP_000356397.1 |
| Coordinates | 5001669..5001959 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R24_RS24555 (4996976) | 4996976..4997905 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
| M5R24_RS24560 (4998087) | 4998087..4998329 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| M5R24_RS24565 (4998619) | 4998619..4999467 | + | 849 | WP_001038650.1 | hypothetical protein | - |
| M5R24_RS24570 (4999492) | 4999492..5000232 | + | 741 | WP_000608806.1 | hypothetical protein | - |
| M5R24_RS24575 (5000417) | 5000417..5000635 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| M5R24_RS24580 (5001032) | 5001032..5001310 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| M5R24_RS24585 (5001669) | 5001669..5001959 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| M5R24_RS24590 (5001960) | 5001960..5002271 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| M5R24_RS24595 (5002500) | 5002500..5003408 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| M5R24_RS24600 (5003472) | 5003472..5004413 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| M5R24_RS24605 (5004458) | 5004458..5004895 | - | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| M5R24_RS24610 (5004892) | 5004892..5005764 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| M5R24_RS24615 (5005758) | 5005758..5006357 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T255578 WP_000897302.1 NZ_CP103562:c5002271-5001960 [Escherichia coli O25b:H4-ST131]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|