Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
| Location | 1975895..1976397 | Replicon | chromosome |
| Accession | NZ_CP103562 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 751 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | E2QNP2 |
| Locus tag | M5R24_RS09435 | Protein ID | WP_000767819.1 |
| Coordinates | 1976143..1976397 (+) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | E2QNP3 |
| Locus tag | M5R24_RS09430 | Protein ID | WP_001259253.1 |
| Coordinates | 1975895..1976146 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R24_RS09405 (1971073) | 1971073..1972140 | - | 1068 | WP_000080057.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
| M5R24_RS09410 (1972140) | 1972140..1973210 | - | 1071 | WP_000108967.1 | histidinol-phosphate transaminase | - |
| M5R24_RS09415 (1973207) | 1973207..1974511 | - | 1305 | WP_001296211.1 | histidinol dehydrogenase | - |
| M5R24_RS09420 (1974517) | 1974517..1975416 | - | 900 | WP_000131782.1 | ATP phosphoribosyltransferase | - |
| M5R24_RS09425 (1975562) | 1975562..1975612 | - | 51 | WP_001364200.1 | his operon leader peptide | - |
| M5R24_RS09430 (1975895) | 1975895..1976146 | + | 252 | WP_001259253.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
| M5R24_RS09435 (1976143) | 1976143..1976397 | + | 255 | WP_000767819.1 | type II toxin-antitoxin system mRNA interferase toxin YoeB | Toxin |
| M5R24_RS09440 (1976480) | 1976480..1977304 | + | 825 | WP_000754737.1 | SDR family oxidoreductase | - |
| M5R24_RS09445 (1977350) | 1977350..1978279 | + | 930 | WP_000803366.1 | LysR substrate-binding domain-containing protein | - |
| M5R24_RS09450 (1978494) | 1978494..1978556 | + | 63 | WP_010723108.1 | membrane protein YoeI | - |
| M5R24_RS09455 (1978546) | 1978546..1979904 | + | 1359 | WP_000019194.1 | putrescine/proton symporter PlaP | - |
| M5R24_RS09460 (1980121) | 1980121..1980579 | + | 459 | WP_001531805.1 | IS200/IS605-like element IS200C family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1980121..1980579 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10110.53 Da Isoelectric Point: 7.2749
>T255562 WP_000767819.1 NZ_CP103562:1976143-1976397 [Escherichia coli O25b:H4-ST131]
VKLIWSEESWDDYLYWQEADKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHLLVYAVTDDSLLIAAC
RYHY
VKLIWSEESWDDYLYWQEADKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHLLVYAVTDDSLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|