Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 5116035..5116637 | Replicon | chromosome |
Accession | NZ_CP103559 | ||
Organism | Escherichia coli strain 3059 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | M5T18_RS24870 | Protein ID | WP_000897305.1 |
Coordinates | 5116326..5116637 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5T18_RS24865 | Protein ID | WP_000356395.1 |
Coordinates | 5116035..5116325 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T18_RS24830 (5111659) | 5111659..5112561 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
M5T18_RS24835 (5112558) | 5112558..5113193 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5T18_RS24840 (5113190) | 5113190..5114119 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
M5T18_RS24845 (5114301) | 5114301..5114543 | - | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
M5T18_RS24850 (5114762) | 5114762..5114980 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
M5T18_RS24855 (5115399) | 5115399..5115677 | - | 279 | WP_001315112.1 | hypothetical protein | - |
M5T18_RS24860 (5115729) | 5115729..5115950 | - | 222 | WP_001550354.1 | hypothetical protein | - |
M5T18_RS24865 (5116035) | 5116035..5116325 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
M5T18_RS24870 (5116326) | 5116326..5116637 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
M5T18_RS24875 (5116866) | 5116866..5117774 | + | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
M5T18_RS24880 (5117942) | 5117942..5118856 | - | 915 | WP_109553727.1 | transposase | - |
M5T18_RS24885 (5118869) | 5118869..5119756 | - | 888 | Protein_4863 | hypothetical protein | - |
M5T18_RS24890 (5120172) | 5120172..5121113 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
M5T18_RS24895 (5121158) | 5121158..5121595 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T255539 WP_000897305.1 NZ_CP103559:c5116637-5116326 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|