Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4206955..4207649 Replicon chromosome
Accession NZ_CP103559
Organism Escherichia coli strain 3059

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag M5T18_RS20575 Protein ID WP_001263491.1
Coordinates 4206955..4207353 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag M5T18_RS20580 Protein ID WP_000554755.1
Coordinates 4207356..4207649 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (4202784) 4202784..4202864 - 81 NuclAT_10 - -
- (4202784) 4202784..4202864 - 81 NuclAT_10 - -
- (4202784) 4202784..4202864 - 81 NuclAT_10 - -
- (4202784) 4202784..4202864 - 81 NuclAT_10 - -
M5T18_RS20545 (4202124) 4202124..4203368 - 1245 WP_000189541.1 esterase FrsA -
M5T18_RS20550 (4203460) 4203460..4203918 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
M5T18_RS20555 (4204179) 4204179..4205636 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
M5T18_RS20560 (4205693) 4205693..4206045 - 353 Protein_4025 peptide chain release factor H -
M5T18_RS20565 (4206041) 4206041..4206247 - 207 Protein_4026 RtcB family protein -
M5T18_RS20570 (4206493) 4206493..4206945 - 453 WP_019842500.1 GNAT family N-acetyltransferase -
M5T18_RS20575 (4206955) 4206955..4207353 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
M5T18_RS20580 (4207356) 4207356..4207649 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
M5T18_RS20585 (4207701) 4207701..4208756 - 1056 WP_001550655.1 DNA polymerase IV -
M5T18_RS20590 (4208827) 4208827..4209612 - 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
M5T18_RS20595 (4209584) 4209584..4211296 + 1713 Protein_4032 flagellar biosynthesis protein FlhA -
M5T18_RS20600 (4211401) 4211401..4211679 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
M5T18_RS20605 (4211672) 4211672..4212028 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4196891..4207649 10758


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T255535 WP_001263491.1 NZ_CP103559:c4207353-4206955 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT255535 WP_000554755.1 NZ_CP103559:c4207649-4207356 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References