Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4206955..4207649 | Replicon | chromosome |
| Accession | NZ_CP103559 | ||
| Organism | Escherichia coli strain 3059 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | M5T18_RS20575 | Protein ID | WP_001263491.1 |
| Coordinates | 4206955..4207353 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | M5T18_RS20580 | Protein ID | WP_000554755.1 |
| Coordinates | 4207356..4207649 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (4202784) | 4202784..4202864 | - | 81 | NuclAT_10 | - | - |
| - (4202784) | 4202784..4202864 | - | 81 | NuclAT_10 | - | - |
| - (4202784) | 4202784..4202864 | - | 81 | NuclAT_10 | - | - |
| - (4202784) | 4202784..4202864 | - | 81 | NuclAT_10 | - | - |
| M5T18_RS20545 (4202124) | 4202124..4203368 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| M5T18_RS20550 (4203460) | 4203460..4203918 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| M5T18_RS20555 (4204179) | 4204179..4205636 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| M5T18_RS20560 (4205693) | 4205693..4206045 | - | 353 | Protein_4025 | peptide chain release factor H | - |
| M5T18_RS20565 (4206041) | 4206041..4206247 | - | 207 | Protein_4026 | RtcB family protein | - |
| M5T18_RS20570 (4206493) | 4206493..4206945 | - | 453 | WP_019842500.1 | GNAT family N-acetyltransferase | - |
| M5T18_RS20575 (4206955) | 4206955..4207353 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| M5T18_RS20580 (4207356) | 4207356..4207649 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| M5T18_RS20585 (4207701) | 4207701..4208756 | - | 1056 | WP_001550655.1 | DNA polymerase IV | - |
| M5T18_RS20590 (4208827) | 4208827..4209612 | - | 786 | WP_019842510.1 | putative lateral flagellar export/assembly protein LafU | - |
| M5T18_RS20595 (4209584) | 4209584..4211296 | + | 1713 | Protein_4032 | flagellar biosynthesis protein FlhA | - |
| M5T18_RS20600 (4211401) | 4211401..4211679 | + | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| M5T18_RS20605 (4211672) | 4211672..4212028 | + | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4196891..4207649 | 10758 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T255535 WP_001263491.1 NZ_CP103559:c4207353-4206955 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |