Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2430244..2430615 | Replicon | chromosome |
| Accession | NZ_CP103559 | ||
| Organism | Escherichia coli strain 3059 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | M5T18_RS11880 | Protein ID | WP_001317028.1 |
| Coordinates | 2430421..2430615 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2430244..2430422 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T18_RS11855 (2426388) | 2426388..2427323 | - | 936 | WP_000662472.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| M5T18_RS11860 (2427375) | 2427375..2428610 | - | 1236 | WP_001551035.1 | site-specific integrase | - |
| M5T18_RS11865 (2428612) | 2428612..2428827 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (2430244) | 2430244..2430422 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2430244) | 2430244..2430422 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2430244) | 2430244..2430422 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2430244) | 2430244..2430422 | + | 179 | NuclAT_0 | - | Antitoxin |
| M5T18_RS11875 (2430240) | 2430240..2430428 | - | 189 | WP_001551036.1 | DUF1187 family protein | - |
| M5T18_RS11880 (2430421) | 2430421..2430615 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| M5T18_RS11885 (2430672) | 2430672..2431481 | - | 810 | WP_001551037.1 | recombination protein RecT | - |
| M5T18_RS11890 (2431474) | 2431474..2434125 | - | 2652 | WP_001551038.1 | exodeoxyribonuclease VIII | - |
| M5T18_RS11895 (2434227) | 2434227..2434502 | - | 276 | WP_001314664.1 | hypothetical protein | - |
| M5T18_RS11900 (2434577) | 2434577..2434747 | - | 171 | WP_001551041.1 | YdaE family protein | - |
| M5T18_RS11905 (2434747) | 2434747..2434968 | - | 222 | WP_000560221.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2427375..2476100 | 48725 | |
| - | inside | Prophage | - | - | 2391965..2476100 | 84135 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T255520 WP_001317028.1 NZ_CP103559:c2430615-2430421 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT255520 NZ_CP103559:2430244-2430422 [Escherichia coli]
GAGGACTGAAGTCTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGGCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTCTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGGCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
