Detailed information of TA system TA255517

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-timR/Ldr(toxin)
• Location: 2234675..2234897
• Replicon: chromosome
• Accession: NZ_CP103559
• Organism: Escherichia coli strain 3059

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: D3H2K1
• Locus tag: M5T18_RS10770
• Protein ID: WP_000170955.1
• Coordinates: 2234675..2234782 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	timR
Locus tag	-
Coordinates	2234830..2234897 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5T18_RS10740 (2230356)	2230356..2231189	+	834	WP_000456570.1	peptide chain release factor N(5)-glutamine methyltransferase	-
M5T18_RS10745 (2231186)	2231186..2231578	+	393	WP_000200377.1	invasion regulator SirB2	-
M5T18_RS10750 (2231582)	2231582..2232391	+	810	WP_135132700.1	invasion regulator SirB1	-
M5T18_RS10755 (2232427)	2232427..2233281	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
M5T18_RS10760 (2233476)	2233476..2233934	+	459	WP_000526135.1	IS200/IS605-like element IS200C family transposase	-
M5T18_RS10765 (2234140)	2234140..2234247	-	108	WP_000176713.1	type I toxin-antitoxin system toxin Ldr family protein	-
- (2234295)	2234295..2234361	+	67	NuclAT_30	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_30	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_30	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_30	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_34	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_34	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_34	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_34	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_38	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_38	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_38	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_38	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_42	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_42	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_42	-	-
- (2234295)	2234295..2234361	+	67	NuclAT_42	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_12	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_12	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_12	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_12	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_14	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_14	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_14	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_14	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_16	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_16	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_16	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_16	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_18	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_18	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_18	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_18	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_20	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_20	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_20	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_20	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_22	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_22	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_22	-	-
- (2234297)	2234297..2234362	+	66	NuclAT_22	-	-
M5T18_RS10770 (2234675)	2234675..2234782	-	108	WP_000170955.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (2234830)	2234830..2234897	+	68	NuclAT_11	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_11	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_11	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_11	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_13	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_13	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_13	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_13	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_15	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_15	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_15	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_15	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_17	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_17	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_17	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_17	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_19	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_19	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_19	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_19	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_21	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_21	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_21	-	Antitoxin
- (2234830)	2234830..2234897	+	68	NuclAT_21	-	Antitoxin
M5T18_RS10775 (2235187)	2235187..2236287	-	1101	WP_001309461.1	sodium-potassium/proton antiporter ChaA	-
M5T18_RS10780 (2236557)	2236557..2236787	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
M5T18_RS10785 (2236945)	2236945..2237640	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
M5T18_RS10790 (2237684)	2237684..2238037	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
M5T18_RS10795 (2238223)	2238223..2239617	+	1395	WP_001718153.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	flank	IS/Tn	-	-	2233476..2233934	458

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4013.82 Da
• Isoelectric Point: 11.4779

>T255517 WP_000170955.1 NZ_CP103559:c2234782-2234675 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 68 bp

>AT255517 NZ_CP103559:2234830-2234897 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Structures

Toxin

• AlphaFold DB: A0A829J2A9

Antitoxin