Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-timR/Ldr(toxin) |
| Location | 2234675..2234897 | Replicon | chromosome |
| Accession | NZ_CP103559 | ||
| Organism | Escherichia coli strain 3059 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | D3H2K1 |
| Locus tag | M5T18_RS10770 | Protein ID | WP_000170955.1 |
| Coordinates | 2234675..2234782 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | timR | ||
| Locus tag | - | ||
| Coordinates | 2234830..2234897 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T18_RS10740 (2230356) | 2230356..2231189 | + | 834 | WP_000456570.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| M5T18_RS10745 (2231186) | 2231186..2231578 | + | 393 | WP_000200377.1 | invasion regulator SirB2 | - |
| M5T18_RS10750 (2231582) | 2231582..2232391 | + | 810 | WP_135132700.1 | invasion regulator SirB1 | - |
| M5T18_RS10755 (2232427) | 2232427..2233281 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| M5T18_RS10760 (2233476) | 2233476..2233934 | + | 459 | WP_000526135.1 | IS200/IS605-like element IS200C family transposase | - |
| M5T18_RS10765 (2234140) | 2234140..2234247 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_30 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_30 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_30 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_30 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_34 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_34 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_34 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_34 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_38 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_38 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_38 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_38 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_42 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_42 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_42 | - | - |
| - (2234295) | 2234295..2234361 | + | 67 | NuclAT_42 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_12 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_12 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_12 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_12 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_14 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_14 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_14 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_14 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_16 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_16 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_16 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_16 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_18 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_18 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_18 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_18 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_20 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_20 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_20 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_20 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_22 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_22 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_22 | - | - |
| - (2234297) | 2234297..2234362 | + | 66 | NuclAT_22 | - | - |
| M5T18_RS10770 (2234675) | 2234675..2234782 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_11 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_11 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_11 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_11 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_13 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_13 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_13 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_13 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_15 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_15 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_15 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_15 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_21 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_21 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_21 | - | Antitoxin |
| - (2234830) | 2234830..2234897 | + | 68 | NuclAT_21 | - | Antitoxin |
| M5T18_RS10775 (2235187) | 2235187..2236287 | - | 1101 | WP_001309461.1 | sodium-potassium/proton antiporter ChaA | - |
| M5T18_RS10780 (2236557) | 2236557..2236787 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| M5T18_RS10785 (2236945) | 2236945..2237640 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| M5T18_RS10790 (2237684) | 2237684..2238037 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| M5T18_RS10795 (2238223) | 2238223..2239617 | + | 1395 | WP_001718153.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2233476..2233934 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T255517 WP_000170955.1 NZ_CP103559:c2234782-2234675 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 68 bp
>AT255517 NZ_CP103559:2234830-2234897 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|