Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 35408..35662 | Replicon | plasmid pMB8413_1 |
| Accession | NZ_CP103558 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4993 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M5T49_RS26730 | Protein ID | WP_001312851.1 |
| Coordinates | 35513..35662 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 35408..35469 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T49_RS26695 (31060) | 31060..31272 | + | 213 | WP_005012601.1 | hypothetical protein | - |
| M5T49_RS26700 (31573) | 31573..31662 | - | 90 | Protein_35 | IS1 family transposase | - |
| M5T49_RS26705 (31717) | 31717..32394 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| M5T49_RS26710 (32394) | 32394..32741 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M5T49_RS26715 (32761) | 32761..34332 | + | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| M5T49_RS26720 (34370) | 34370..34986 | - | 617 | Protein_39 | IS1-like element IS1A family transposase | - |
| M5T49_RS26725 (35087) | 35087..35269 | + | 183 | WP_000968309.1 | hypothetical protein | - |
| - (35408) | 35408..35469 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (35408) | 35408..35469 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (35408) | 35408..35469 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (35408) | 35408..35469 | - | 62 | NuclAT_0 | - | Antitoxin |
| M5T49_RS26730 (35513) | 35513..35662 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M5T49_RS26735 (35946) | 35946..36203 | + | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| M5T49_RS26740 (36439) | 36439..36513 | + | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| M5T49_RS26745 (36506) | 36506..36952 | + | 447 | Protein_44 | plasmid replication initiator RepA | - |
| M5T49_RS26750 (36952) | 36952..37566 | - | 615 | Protein_45 | VENN motif pre-toxin domain-containing protein | - |
| M5T49_RS26755 (38273) | 38273..39493 | + | 1221 | WP_000410951.1 | arginine deiminase | - |
| M5T49_RS26760 (39504) | 39504..40415 | + | 912 | WP_000440183.1 | carbamate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) | senB / iucD / iutA | 1..125598 | 125598 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T255505 WP_001312851.1 NZ_CP103558:35513-35662 [Escherichia coli O25b:H4-ST131]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT255505 NZ_CP103558:c35469-35408 [Escherichia coli O25b:H4-ST131]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
