Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3824174..3824853 | Replicon | chromosome |
| Accession | NZ_CP103557 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4993 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | M5T49_RS19295 | Protein ID | WP_000057523.1 |
| Coordinates | 3824551..3824853 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | M5T49_RS19290 | Protein ID | WP_000806442.1 |
| Coordinates | 3824174..3824515 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T49_RS19280 (3820418) | 3820418..3821350 | - | 933 | WP_000883041.1 | glutaminase A | - |
| M5T49_RS19285 (3821612) | 3821612..3824116 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| M5T49_RS19290 (3824174) | 3824174..3824515 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| M5T49_RS19295 (3824551) | 3824551..3824853 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T49_RS19300 (3824986) | 3824986..3825780 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| M5T49_RS19305 (3825984) | 3825984..3826463 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| M5T49_RS19310 (3826631) | 3826631..3827287 | + | 657 | WP_015674862.1 | hypothetical protein | - |
| M5T49_RS19315 (3827284) | 3827284..3827787 | + | 504 | WP_000667000.1 | hypothetical protein | - |
| M5T49_RS19320 (3827825) | 3827825..3829477 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T255495 WP_000057523.1 NZ_CP103557:c3824853-3824551 [Escherichia coli O25b:H4-ST131]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT255495 WP_000806442.1 NZ_CP103557:c3824515-3824174 [Escherichia coli O25b:H4-ST131]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|