Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 600161..600960 | Replicon | chromosome |
Accession | NZ_CP103557 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 4993 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | M5T49_RS02950 | Protein ID | WP_000347251.1 |
Coordinates | 600161..600625 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | M5T49_RS02955 | Protein ID | WP_001296435.1 |
Coordinates | 600625..600960 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T49_RS02920 (595162) | 595162..595596 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
M5T49_RS02925 (595614) | 595614..596492 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
M5T49_RS02930 (596482) | 596482..597261 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
M5T49_RS02935 (597272) | 597272..597745 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
M5T49_RS02940 (597768) | 597768..599048 | - | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
M5T49_RS02945 (599297) | 599297..600106 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
M5T49_RS02950 (600161) | 600161..600625 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
M5T49_RS02955 (600625) | 600625..600960 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
M5T49_RS02960 (601109) | 601109..602680 | - | 1572 | WP_001273763.1 | galactarate dehydratase | - |
M5T49_RS02965 (603055) | 603055..604389 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
M5T49_RS02970 (604405) | 604405..605175 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T255483 WP_000347251.1 NZ_CP103557:c600625-600161 [Escherichia coli O25b:H4-ST131]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Download Length: 112 a.a. Molecular weight: 12321.92 Da Isoelectric Point: 4.5392
>AT255483 WP_001296435.1 NZ_CP103557:c600960-600625 [Escherichia coli O25b:H4-ST131]
MPANARSNAVLTTESKVTIRGQTTIPAPVREALKLKPGLDSIHYEILPGGQVFMCRLGDEQEDHTMNAFLRFLDADIQNN
PQKTRPFDIQQGKKLVAGMDVNIDDEIGDDE
MPANARSNAVLTTESKVTIRGQTTIPAPVREALKLKPGLDSIHYEILPGGQVFMCRLGDEQEDHTMNAFLRFLDADIQNN
PQKTRPFDIQQGKKLVAGMDVNIDDEIGDDE
Download Length: 336 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |