Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 40525..41175 | Replicon | chromosome |
| Accession | NZ_CP103554 | ||
| Organism | Klebsiella michiganensis strain 5088 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A0H3H3K0 |
| Locus tag | M5R35_RS00195 | Protein ID | WP_014227314.1 |
| Coordinates | 40525..40866 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0H3H3Q5 |
| Locus tag | M5R35_RS00200 | Protein ID | WP_014227313.1 |
| Coordinates | 40876..41175 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R35_RS00180 (M5R35_00180) | 36517..37836 | + | 1320 | WP_014227316.1 | MFS transporter | - |
| M5R35_RS00185 (M5R35_00185) | 37982..39373 | + | 1392 | WP_014227315.1 | hexose-6-phosphate:phosphate antiporter | - |
| M5R35_RS00190 (M5R35_00190) | 39822..40274 | + | 453 | WP_009653860.1 | DUF1198 domain-containing protein | - |
| M5R35_RS00195 (M5R35_00195) | 40525..40866 | + | 342 | WP_014227314.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5R35_RS00200 (M5R35_00200) | 40876..41175 | + | 300 | WP_014227313.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M5R35_RS00205 (M5R35_00205) | 41294..42475 | + | 1182 | WP_014227312.1 | purine ribonucleoside efflux pump NepI | - |
| M5R35_RS00210 (M5R35_00210) | 42508..43317 | - | 810 | WP_038422921.1 | phosphonoacetaldehyde hydrolase | - |
| M5R35_RS00215 (M5R35_00215) | 43327..44430 | - | 1104 | WP_014227310.1 | 2-aminoethylphosphonate--pyruvate transaminase | - |
| M5R35_RS00220 (M5R35_00220) | 44571..45290 | + | 720 | WP_014227309.1 | phosphonate utilization transcriptional regulator PhnR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13110.00 Da Isoelectric Point: 5.7545
>T255467 WP_014227314.1 NZ_CP103554:40525-40866 [Klebsiella michiganensis]
MWDVETTEVFDKWFEAQTEALKEDMLAAMVILSEYGPRLGRPFADTVNDSAFSNMKELRIQHQGRPIRAFFVFDPSRCGI
VLCAGDKTGLNEKRFYKDMIKLADAEYRKHLNQ
MWDVETTEVFDKWFEAQTEALKEDMLAAMVILSEYGPRLGRPFADTVNDSAFSNMKELRIQHQGRPIRAFFVFDPSRCGI
VLCAGDKTGLNEKRFYKDMIKLADAEYRKHLNQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H3K0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H3Q5 |