Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3639742..3640328 Replicon chromosome
Accession NZ_CP103548
Organism Klebsiella pneumoniae strain 3987

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M5T27_RS17920 Protein ID WP_002920800.1
Coordinates 3639742..3640110 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M5T27_RS17925 Protein ID WP_004174006.1
Coordinates 3640107..3640328 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T27_RS17900 (3635245) 3635245..3636315 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
M5T27_RS17905 (3636317) 3636317..3637162 - 846 WP_032434559.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M5T27_RS17910 (3637159) 3637159..3638046 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M5T27_RS17915 (3638153) 3638153..3639469 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M5T27_RS17920 (3639742) 3639742..3640110 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5T27_RS17925 (3640107) 3640107..3640328 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5T27_RS17930 (3640492) 3640492..3641205 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M5T27_RS17935 (3641207) 3641207..3641974 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M5T27_RS17940 (3641971) 3641971..3643248 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M5T27_RS17945 (3643245) 3643245..3644171 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3634508..3643248 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T255443 WP_002920800.1 NZ_CP103548:c3640110-3639742 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT255443 WP_004174006.1 NZ_CP103548:c3640328-3640107 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References