Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 1527868..1528557 | Replicon | chromosome |
| Accession | NZ_CP103548 | ||
| Organism | Klebsiella pneumoniae strain 3987 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A331C6E2 |
| Locus tag | M5T27_RS07420 | Protein ID | WP_021469727.1 |
| Coordinates | 1528240..1528557 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A6B0N7G3 |
| Locus tag | M5T27_RS07415 | Protein ID | WP_020804705.1 |
| Coordinates | 1527868..1528164 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T27_RS07400 (1524260) | 1524260..1525642 | + | 1383 | WP_004151222.1 | MFS transporter | - |
| M5T27_RS07405 (1525686) | 1525686..1527302 | + | 1617 | WP_004175961.1 | carbohydrate porin | - |
| M5T27_RS07410 (1527343) | 1527343..1527789 | - | 447 | WP_032435212.1 | hypothetical protein | - |
| M5T27_RS07415 (1527868) | 1527868..1528164 | - | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
| M5T27_RS07420 (1528240) | 1528240..1528557 | - | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T27_RS07425 (1528764) | 1528764..1528991 | - | 228 | WP_002906690.1 | tautomerase PptA | - |
| M5T27_RS07430 (1529062) | 1529062..1529679 | - | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
| M5T27_RS07435 (1529757) | 1529757..1530608 | - | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
| M5T27_RS07440 (1530647) | 1530647..1531426 | - | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
| M5T27_RS07445 (1531410) | 1531410..1532336 | - | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
| M5T27_RS07450 (1532346) | 1532346..1532855 | - | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T255436 WP_021469727.1 NZ_CP103548:c1528557-1528240 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A331C6E2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6B0N7G3 |