Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 62599..62863 Replicon plasmid pMB9029_2
Accession NZ_CP103546
Organism Escherichia coli strain 3036

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag M5S54_RS24080 Protein ID WP_001303307.1
Coordinates 62599..62751 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 62801..62863 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S54_RS24050 (57882) 57882..58544 + 663 WP_000644794.1 plasmid IncI1-type surface exclusion protein ExcA -
M5S54_RS24055 (58616) 58616..58825 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
M5S54_RS24060 (59217) 59217..59393 + 177 WP_001054900.1 hypothetical protein -
- (59879) 59879..59930 + 52 NuclAT_1 - -
- (59879) 59879..59930 + 52 NuclAT_1 - -
- (59879) 59879..59930 + 52 NuclAT_1 - -
- (59879) 59879..59930 + 52 NuclAT_1 - -
M5S54_RS24065 (60114) 60114..61136 + 1023 WP_001572805.1 IS21-like element IS100 family transposase -
M5S54_RS24070 (61133) 61133..61915 + 783 WP_001300609.1 IS21-like element IS100kyp family helper ATPase IstB -
M5S54_RS24075 (62276) 62276..62527 + 252 WP_001291965.1 hypothetical protein -
M5S54_RS24080 (62599) 62599..62751 - 153 WP_001303307.1 Hok/Gef family protein Toxin
- (62801) 62801..62863 + 63 NuclAT_0 - Antitoxin
- (62801) 62801..62863 + 63 NuclAT_0 - Antitoxin
- (62801) 62801..62863 + 63 NuclAT_0 - Antitoxin
- (62801) 62801..62863 + 63 NuclAT_0 - Antitoxin
M5S54_RS24085 (63043) 63043..64251 + 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
M5S54_RS24090 (64270) 64270..65340 + 1071 WP_000151575.1 IncI1-type conjugal transfer protein TrbB -
M5S54_RS24095 (65333) 65333..67624 + 2292 WP_001289271.1 F-type conjugative transfer protein TrbC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCMY-2 - 1..98998 98998


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T255429 WP_001303307.1 NZ_CP103546:c62751-62599 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT255429 NZ_CP103546:62801-62863 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References