Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 107393..107819 | Replicon | plasmid pMB9029_1 |
| Accession | NZ_CP103545 | ||
| Organism | Escherichia coli strain 3036 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | M5S54_RS23585 | Protein ID | WP_001372321.1 |
| Coordinates | 107393..107518 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 107595..107819 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S54_RS23545 (102765) | 102765..103454 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| M5S54_RS23550 (103641) | 103641..104024 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| M5S54_RS23555 (104345) | 104345..104947 | + | 603 | WP_072156291.1 | transglycosylase SLT domain-containing protein | - |
| M5S54_RS23560 (105244) | 105244..106065 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| M5S54_RS23565 (106184) | 106184..106471 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| M5S54_RS23570 (106496) | 106496..106702 | - | 207 | WP_000547971.1 | hypothetical protein | - |
| M5S54_RS23575 (106772) | 106772..106945 | + | 174 | Protein_128 | hypothetical protein | - |
| M5S54_RS23580 (106943) | 106943..107173 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| M5S54_RS23585 (107393) | 107393..107518 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M5S54_RS23590 (107460) | 107460..107609 | - | 150 | Protein_131 | plasmid maintenance protein Mok | - |
| - (107595) | 107595..107819 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (107595) | 107595..107819 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (107595) | 107595..107819 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (107595) | 107595..107819 | - | 225 | NuclAT_0 | - | Antitoxin |
| M5S54_RS23595 (107631) | 107631..107819 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| M5S54_RS23600 (107788) | 107788..108550 | - | 763 | Protein_133 | plasmid SOS inhibition protein A | - |
| M5S54_RS23605 (108547) | 108547..108981 | - | 435 | WP_064770609.1 | conjugation system SOS inhibitor PsiB | - |
| M5S54_RS23610 (109036) | 109036..109233 | - | 198 | Protein_135 | hypothetical protein | - |
| M5S54_RS23615 (109261) | 109261..109494 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
| M5S54_RS23620 (109562) | 109562..110101 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| M5S54_RS23625 (110127) | 110127..110333 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| M5S54_RS23630 (110403) | 110403..110483 | + | 81 | Protein_139 | hypothetical protein | - |
| M5S54_RS23635 (110666) | 110666..110835 | - | 170 | Protein_140 | hypothetical protein | - |
| M5S54_RS23640 (111472) | 111472..112443 | - | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 / tet(A) / catA2 / sul3 / ant(3'')-Ia / floR / aac(3)-IIa / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..132824 | 132824 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T255425 WP_001372321.1 NZ_CP103545:c107518-107393 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT255425 NZ_CP103545:c107819-107595 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|