Detailed information of TA system TA255425

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 107393..107819
• Replicon: plasmid pMB9029_1
• Accession: NZ_CP103545
• Organism: Escherichia coli strain 3036

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M5S54_RS23585
• Protein ID: WP_001372321.1
• Coordinates: 107393..107518 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	107595..107819 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5S54_RS23545 (102765)	102765..103454	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
M5S54_RS23550 (103641)	103641..104024	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M5S54_RS23555 (104345)	104345..104947	+	603	WP_072156291.1	transglycosylase SLT domain-containing protein	-
M5S54_RS23560 (105244)	105244..106065	-	822	WP_001234469.1	DUF932 domain-containing protein	-
M5S54_RS23565 (106184)	106184..106471	-	288	WP_000107535.1	hypothetical protein	-
M5S54_RS23570 (106496)	106496..106702	-	207	WP_000547971.1	hypothetical protein	-
M5S54_RS23575 (106772)	106772..106945	+	174	Protein_128	hypothetical protein	-
M5S54_RS23580 (106943)	106943..107173	-	231	WP_001426396.1	hypothetical protein	-
M5S54_RS23585 (107393)	107393..107518	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5S54_RS23590 (107460)	107460..107609	-	150	Protein_131	plasmid maintenance protein Mok	-
- (107595)	107595..107819	-	225	NuclAT_0	-	Antitoxin
- (107595)	107595..107819	-	225	NuclAT_0	-	Antitoxin
- (107595)	107595..107819	-	225	NuclAT_0	-	Antitoxin
- (107595)	107595..107819	-	225	NuclAT_0	-	Antitoxin
M5S54_RS23595 (107631)	107631..107819	+	189	WP_001299721.1	hypothetical protein	-
M5S54_RS23600 (107788)	107788..108550	-	763	Protein_133	plasmid SOS inhibition protein A	-
M5S54_RS23605 (108547)	108547..108981	-	435	WP_064770609.1	conjugation system SOS inhibitor PsiB	-
M5S54_RS23610 (109036)	109036..109233	-	198	Protein_135	hypothetical protein	-
M5S54_RS23615 (109261)	109261..109494	-	234	WP_000005987.1	DUF905 family protein	-
M5S54_RS23620 (109562)	109562..110101	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
M5S54_RS23625 (110127)	110127..110333	-	207	WP_000275856.1	hypothetical protein	-
M5S54_RS23630 (110403)	110403..110483	+	81	Protein_139	hypothetical protein	-
M5S54_RS23635 (110666)	110666..110835	-	170	Protein_140	hypothetical protein	-
M5S54_RS23640 (111472)	111472..112443	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-55 / tet(A) / catA2 / sul3 / ant(3'')-Ia / floR / aac(3)-IIa / sitABCD	iutA / iucD / iucC / iucB / iucA	1..132824	132824

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T255425 WP_001372321.1 NZ_CP103545:c107518-107393 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT255425 NZ_CP103545:c107819-107595 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin