Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 68277..68531 | Replicon | plasmid pMB9029_1 |
| Accession | NZ_CP103545 | ||
| Organism | Escherichia coli strain 3036 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M5S54_RS23345 | Protein ID | WP_001312851.1 |
| Coordinates | 68277..68426 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 68470..68531 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S54_RS23300 (63829) | 63829..64230 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M5S54_RS23305 (64163) | 64163..64420 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M5S54_RS23310 (64513) | 64513..65166 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M5S54_RS23315 (65264) | 65264..65404 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| M5S54_RS23320 (66105) | 66105..66962 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| M5S54_RS23325 (66955) | 66955..67437 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| M5S54_RS23330 (67430) | 67430..67477 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| M5S54_RS23335 (67468) | 67468..67719 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| M5S54_RS23340 (67736) | 67736..67993 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| M5S54_RS23345 (68277) | 68277..68426 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (68470) | 68470..68531 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (68470) | 68470..68531 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (68470) | 68470..68531 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (68470) | 68470..68531 | + | 62 | NuclAT_1 | - | Antitoxin |
| M5S54_RS23350 (68787) | 68787..68861 | - | 75 | Protein_83 | endonuclease | - |
| M5S54_RS23355 (69107) | 69107..69319 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| M5S54_RS23360 (69455) | 69455..70015 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| M5S54_RS23365 (70118) | 70118..70978 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| M5S54_RS23370 (71037) | 71037..71783 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 / tet(A) / catA2 / sul3 / ant(3'')-Ia / floR / aac(3)-IIa / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..132824 | 132824 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T255420 WP_001312851.1 NZ_CP103545:c68426-68277 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT255420 NZ_CP103545:68470-68531 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|