Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4568503..4569105 | Replicon | chromosome |
Accession | NZ_CP103544 | ||
Organism | Escherichia coli strain 3036 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | M5S54_RS21945 | Protein ID | WP_000897305.1 |
Coordinates | 4568794..4569105 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5S54_RS21940 | Protein ID | WP_000356397.1 |
Coordinates | 4568503..4568793 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S54_RS21915 (4564428) | 4564428..4565330 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
M5S54_RS21920 (4565327) | 4565327..4565962 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5S54_RS21925 (4565959) | 4565959..4566888 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
M5S54_RS21930 (4567218) | 4567218..4567460 | - | 243 | WP_001087409.1 | protein YiiF | - |
M5S54_RS21935 (4567680) | 4567680..4567898 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
M5S54_RS21940 (4568503) | 4568503..4568793 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
M5S54_RS21945 (4568794) | 4568794..4569105 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
M5S54_RS21950 (4569334) | 4569334..4570242 | + | 909 | WP_259418694.1 | alpha/beta hydrolase | - |
M5S54_RS21955 (4570306) | 4570306..4571247 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
M5S54_RS21960 (4571292) | 4571292..4571729 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
M5S54_RS21965 (4571726) | 4571726..4572598 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
M5S54_RS21970 (4572592) | 4572592..4573191 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
M5S54_RS21975 (4573290) | 4573290..4574075 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T255417 WP_000897305.1 NZ_CP103544:c4569105-4568794 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|