Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2702781..2703001 | Replicon | chromosome |
| Accession | NZ_CP103544 | ||
| Organism | Escherichia coli strain 3036 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A8S7XT81 |
| Locus tag | M5S54_RS13125 | Protein ID | WP_074147554.1 |
| Coordinates | 2702894..2703001 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2702781..2702847 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S54_RS13100 | 2698060..2699454 | - | 1395 | WP_000086201.1 | inverse autotransporter invasin YchO | - |
| M5S54_RS13105 | 2699639..2699992 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| M5S54_RS13110 | 2700036..2700731 | - | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| M5S54_RS13115 | 2700889..2701119 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| M5S54_RS13120 | 2701389..2702489 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 2702781..2702847 | - | 67 | - | - | Antitoxin |
| M5S54_RS13125 | 2702894..2703001 | + | 108 | WP_074147554.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2703314..2703377 | - | 64 | NuclAT_35 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_35 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_35 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_35 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_38 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_38 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_38 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_38 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_41 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_41 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_41 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_41 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_44 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_44 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_44 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_44 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_47 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_47 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_47 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_47 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_50 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_50 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_50 | - | - |
| - | 2703314..2703377 | - | 64 | NuclAT_50 | - | - |
| - | 2703315..2703377 | - | 63 | NuclAT_52 | - | - |
| - | 2703315..2703377 | - | 63 | NuclAT_52 | - | - |
| - | 2703315..2703377 | - | 63 | NuclAT_52 | - | - |
| - | 2703315..2703377 | - | 63 | NuclAT_52 | - | - |
| - | 2703315..2703377 | - | 63 | NuclAT_55 | - | - |
| - | 2703315..2703377 | - | 63 | NuclAT_55 | - | - |
| - | 2703315..2703377 | - | 63 | NuclAT_55 | - | - |
| - | 2703315..2703377 | - | 63 | NuclAT_55 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_17 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_17 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_17 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_17 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_20 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_20 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_20 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_20 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_23 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_23 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_23 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_23 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_26 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_26 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_26 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_26 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_29 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_29 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_29 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_29 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_32 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_32 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_32 | - | - |
| - | 2703316..2703377 | - | 62 | NuclAT_32 | - | - |
| M5S54_RS13130 | 2703430..2703537 | + | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2703850..2703915 | - | 66 | NuclAT_34 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_34 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_34 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_34 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_37 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_37 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_37 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_37 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_40 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_40 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_40 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_40 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_43 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_43 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_43 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_43 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_46 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_46 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_46 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_46 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_49 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_49 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_49 | - | - |
| - | 2703850..2703915 | - | 66 | NuclAT_49 | - | - |
| - | 2703851..2703917 | - | 67 | NuclAT_51 | - | - |
| - | 2703851..2703917 | - | 67 | NuclAT_51 | - | - |
| - | 2703851..2703917 | - | 67 | NuclAT_51 | - | - |
| - | 2703851..2703917 | - | 67 | NuclAT_51 | - | - |
| - | 2703851..2703917 | - | 67 | NuclAT_54 | - | - |
| - | 2703851..2703917 | - | 67 | NuclAT_54 | - | - |
| - | 2703851..2703917 | - | 67 | NuclAT_54 | - | - |
| - | 2703851..2703917 | - | 67 | NuclAT_54 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_16 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_16 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_16 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_16 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_19 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_19 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_19 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_19 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_22 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_22 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_22 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_22 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_25 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_25 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_25 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_25 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_28 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_28 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_28 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_28 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_31 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_31 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_31 | - | - |
| - | 2703852..2703915 | - | 64 | NuclAT_31 | - | - |
| M5S54_RS13135 | 2703965..2704072 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| M5S54_RS13140 | 2704221..2705075 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| M5S54_RS13145 | 2705111..2705920 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| M5S54_RS13150 | 2705924..2706316 | - | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| M5S54_RS13155 | 2706313..2707146 | - | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T255411 WP_074147554.1 NZ_CP103544:2702894-2703001 [Escherichia coli]
MTLAQFAMTFWHDLAAPILTGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILTGIITAAIVSWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT255411 NZ_CP103544:c2702847-2702781 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|