Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3701066..3701760 | Replicon | chromosome |
Accession | NZ_CP103540 | ||
Organism | Escherichia coli strain 5264 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | M5S66_RS17960 | Protein ID | WP_001263489.1 |
Coordinates | 3701066..3701464 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | M5S66_RS17965 | Protein ID | WP_000554758.1 |
Coordinates | 3701467..3701760 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3696654) | 3696654..3696734 | - | 81 | NuclAT_13 | - | - |
- (3696654) | 3696654..3696734 | - | 81 | NuclAT_13 | - | - |
- (3696654) | 3696654..3696734 | - | 81 | NuclAT_13 | - | - |
- (3696654) | 3696654..3696734 | - | 81 | NuclAT_13 | - | - |
M5S66_RS17935 (3697330) | 3697330..3697788 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
M5S66_RS17940 (3698049) | 3698049..3699506 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
M5S66_RS17945 (3699563) | 3699563..3700084 | - | 522 | Protein_3507 | peptide chain release factor H | - |
M5S66_RS17950 (3700080) | 3700080..3700286 | - | 207 | Protein_3508 | RtcB family protein | - |
M5S66_RS17955 (3700604) | 3700604..3701056 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
M5S66_RS17960 (3701066) | 3701066..3701464 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
M5S66_RS17965 (3701467) | 3701467..3701760 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
M5S66_RS17970 (3701812) | 3701812..3702867 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
M5S66_RS17975 (3702938) | 3702938..3703723 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
M5S66_RS17980 (3703695) | 3703695..3705407 | + | 1713 | Protein_3514 | flagellar biosynthesis protein FlhA | - |
M5S66_RS17985 (3705631) | 3705631..3706128 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T255391 WP_001263489.1 NZ_CP103540:c3701464-3701066 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |