Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2406288..2406926 | Replicon | chromosome |
Accession | NZ_CP103540 | ||
Organism | Escherichia coli strain 5264 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | M5S66_RS11580 | Protein ID | WP_001447010.1 |
Coordinates | 2406750..2406926 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M5S66_RS11575 | Protein ID | WP_001270286.1 |
Coordinates | 2406288..2406704 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S66_RS11555 (2401440) | 2401440..2402381 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
M5S66_RS11560 (2402382) | 2402382..2403395 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
M5S66_RS11565 (2403413) | 2403413..2404558 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
M5S66_RS11570 (2404803) | 2404803..2406209 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
M5S66_RS11575 (2406288) | 2406288..2406704 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
M5S66_RS11580 (2406750) | 2406750..2406926 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
M5S66_RS11585 (2407148) | 2407148..2407378 | + | 231 | WP_000494244.1 | YncJ family protein | - |
M5S66_RS11590 (2407470) | 2407470..2409431 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
M5S66_RS11595 (2409504) | 2409504..2410040 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
M5S66_RS11600 (2410132) | 2410132..2411307 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2411347..2412495 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T255389 WP_001447010.1 NZ_CP103540:c2406926-2406750 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT255389 WP_001270286.1 NZ_CP103540:c2406704-2406288 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|