Detailed information of TA system TA255373

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 79829..80255
• Replicon: plasmid pMB9108_1
• Accession: NZ_CP103534
• Organism: Escherichia coli strain 4238

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M5T38_RS23780
• Protein ID: WP_001372321.1
• Coordinates: 79829..79954 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	80031..80255 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5T38_RS23740 (75201)	75201..75890	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
M5T38_RS23745 (76077)	76077..76460	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M5T38_RS23750 (76781)	76781..77383	+	603	WP_072156291.1	transglycosylase SLT domain-containing protein	-
M5T38_RS23755 (77680)	77680..78501	-	822	WP_001234469.1	DUF932 domain-containing protein	-
M5T38_RS23760 (78620)	78620..78907	-	288	WP_000107535.1	hypothetical protein	-
M5T38_RS23765 (78932)	78932..79138	-	207	WP_000547971.1	hypothetical protein	-
M5T38_RS23770 (79208)	79208..79381	+	174	Protein_99	hypothetical protein	-
M5T38_RS23775 (79379)	79379..79609	-	231	WP_001426396.1	hypothetical protein	-
M5T38_RS23780 (79829)	79829..79954	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5T38_RS23785 (79896)	79896..80045	-	150	Protein_102	plasmid maintenance protein Mok	-
- (80031)	80031..80255	-	225	NuclAT_0	-	Antitoxin
- (80031)	80031..80255	-	225	NuclAT_0	-	Antitoxin
- (80031)	80031..80255	-	225	NuclAT_0	-	Antitoxin
- (80031)	80031..80255	-	225	NuclAT_0	-	Antitoxin
M5T38_RS23790 (80067)	80067..80255	+	189	WP_001299721.1	hypothetical protein	-
M5T38_RS23795 (80224)	80224..80986	-	763	Protein_104	plasmid SOS inhibition protein A	-
M5T38_RS23800 (80983)	80983..81417	-	435	WP_064770609.1	conjugation system SOS inhibitor PsiB	-
M5T38_RS23805 (81472)	81472..81669	-	198	Protein_106	hypothetical protein	-
M5T38_RS23810 (81697)	81697..81930	-	234	WP_000005987.1	DUF905 family protein	-
M5T38_RS23815 (81998)	81998..82537	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
M5T38_RS23820 (82563)	82563..82769	-	207	WP_000275856.1	hypothetical protein	-
M5T38_RS23825 (82839)	82839..82919	+	81	Protein_110	hypothetical protein	-
M5T38_RS23830 (83102)	83102..83271	-	170	Protein_111	hypothetical protein	-
M5T38_RS23835 (83908)	83908..84879	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaCTX-M-55 / aph(3')-Ia / catA2 / dfrA14 / ant(3'')-Ia / lnu(F) / sul3 / aac(3)-IIa / sitABCD	iutA / iucD / iucC / iucB / iucA	1..105260	105260

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T255373 WP_001372321.1 NZ_CP103534:c79954-79829 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT255373 NZ_CP103534:c80255-80031 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin