Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 67341..67595 | Replicon | plasmid pMB9108_1 |
| Accession | NZ_CP103534 | ||
| Organism | Escherichia coli strain 4238 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M5T38_RS23675 | Protein ID | WP_001312851.1 |
| Coordinates | 67341..67490 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 67534..67595 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T38_RS23635 (62893) | 62893..63294 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M5T38_RS23640 (63227) | 63227..63484 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M5T38_RS23645 (63577) | 63577..64230 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M5T38_RS23650 (65169) | 65169..66026 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| M5T38_RS23655 (66019) | 66019..66501 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| M5T38_RS23660 (66494) | 66494..66541 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| M5T38_RS23665 (66532) | 66532..66783 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| M5T38_RS23670 (66800) | 66800..67057 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| M5T38_RS23675 (67341) | 67341..67490 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (67534) | 67534..67595 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (67534) | 67534..67595 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (67534) | 67534..67595 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (67534) | 67534..67595 | + | 62 | NuclAT_1 | - | Antitoxin |
| M5T38_RS23680 (67851) | 67851..67925 | - | 75 | Protein_81 | endonuclease | - |
| M5T38_RS23685 (68171) | 68171..68383 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| M5T38_RS23690 (68519) | 68519..69079 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| M5T38_RS23695 (69182) | 69182..70042 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| M5T38_RS23700 (70101) | 70101..70847 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
| M5T38_RS23705 (70867) | 70867..72480 | - | 1614 | Protein_86 | conjugative transfer relaxase/helicase TraI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-55 / aph(3')-Ia / catA2 / dfrA14 / ant(3'')-Ia / lnu(F) / sul3 / aac(3)-IIa / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..105260 | 105260 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T255369 WP_001312851.1 NZ_CP103534:c67490-67341 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT255369 NZ_CP103534:67534-67595 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
