Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1123073..1123800 | Replicon | chromosome |
| Accession | NZ_CP103533 | ||
| Organism | Escherichia coli strain 4238 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | J7Q991 |
| Locus tag | M5T38_RS05465 | Protein ID | WP_000547564.1 |
| Coordinates | 1123073..1123384 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M5T38_RS05470 | Protein ID | WP_000126294.1 |
| Coordinates | 1123381..1123800 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T38_RS05435 (1118215) | 1118215..1119924 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
| M5T38_RS05440 (1119934) | 1119934..1120476 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
| M5T38_RS05445 (1120476) | 1120476..1121243 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| M5T38_RS05450 (1121240) | 1121240..1121650 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
| M5T38_RS05455 (1121643) | 1121643..1122113 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| M5T38_RS05460 (1122138) | 1122138..1122899 | + | 762 | WP_001026446.1 | hypothetical protein | - |
| M5T38_RS05465 (1123073) | 1123073..1123384 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| M5T38_RS05470 (1123381) | 1123381..1123800 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| M5T38_RS05475 (1123914) | 1123914..1125338 | - | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
| M5T38_RS05480 (1125347) | 1125347..1126804 | - | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| M5T38_RS05485 (1127064) | 1127064..1128074 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
| M5T38_RS05490 (1128223) | 1128223..1128750 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T255357 WP_000547564.1 NZ_CP103533:1123073-1123384 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT255357 WP_000126294.1 NZ_CP103533:1123381-1123800 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|