Detailed information of TA system TA255346

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 26102..26523
• Replicon: plasmid pMB9245_1
• Accession: NZ_CP103530
• Organism: Escherichia coli strain 5270

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M5T24_RS24275
• Protein ID: WP_001375150.1
• Coordinates: 26407..26523 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	26102..26300 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5T24_RS24235 (21798)	21798..23192	+	1395	WP_001037799.1	carbohydrate porin	-
M5T24_RS24240 (23438)	23438..23542	-	105	Protein_21	thiosulfate reductase cytochrome B subunit	-
M5T24_RS24245 (23599)	23599..24292	+	694	Protein_22	IS1 family transposase	-
M5T24_RS24250 (24419)	24419..24931	+	513	WP_223350513.1	potassium channel family protein	-
M5T24_RS24255 (25016)	25016..25267	+	252	Protein_24	iron-containing alcohol dehydrogenase	-
M5T24_RS24260 (25556)	25556..25873	-	318	Protein_25	IS110 family transposase	-
M5T24_RS24265 (26028)	26028..26133	+	106	Protein_26	plasmid SOS inhibition protein A	-
- (26102)	26102..26300	+	199	NuclAT_0	-	Antitoxin
- (26102)	26102..26300	+	199	NuclAT_0	-	Antitoxin
- (26102)	26102..26300	+	199	NuclAT_0	-	Antitoxin
- (26102)	26102..26300	+	199	NuclAT_0	-	Antitoxin
M5T24_RS24270 (26307)	26307..26456	+	150	Protein_27	DUF5431 family protein	-
M5T24_RS24275 (26407)	26407..26523	+	117	WP_001375150.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5T24_RS24280 (26824)	26824..27121	-	298	Protein_29	hypothetical protein	-
M5T24_RS24285 (27191)	27191..27397	+	207	WP_000275854.1	hypothetical protein	-
M5T24_RS24290 (27422)	27422..27709	+	288	WP_000107242.1	hypothetical protein	-
M5T24_RS24295 (27828)	27828..28649	+	822	WP_001234465.1	DUF932 domain-containing protein	-
M5T24_RS24300 (28945)	28945..29517	-	573	WP_000949660.1	transglycosylase SLT domain-containing protein	-
M5T24_RS24305 (29887)	29887..30270	+	384	WP_001063020.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M5T24_RS24310 (30461)	30461..31108	+	648	WP_000332520.1	conjugal transfer transcriptional regulator TraJ	-
M5T24_RS24315 (31244)	31244..31459	+	216	WP_001352842.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / rmtB / blaTEM-1B / mph(A)	-	1..133836	133836
	-	flank	IS/Tn	-	-	23915..24292	377

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (1-34)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4481.27 Da
• Isoelectric Point: 8.4890

>T255346 WP_001375150.1 NZ_CP103530:26407-26523 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 117 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT255346 NZ_CP103530:26102-26300 [Escherichia coli]
TCACACAGATTACCCGTAAACAGTCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin