Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3939342..3940036 | Replicon | chromosome |
Accession | NZ_CP103529 | ||
Organism | Escherichia coli strain 5270 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | M5T24_RS19080 | Protein ID | WP_001263489.1 |
Coordinates | 3939342..3939740 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | M5T24_RS19085 | Protein ID | WP_000554758.1 |
Coordinates | 3939743..3940036 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3934930) | 3934930..3935010 | - | 81 | NuclAT_13 | - | - |
- (3934930) | 3934930..3935010 | - | 81 | NuclAT_13 | - | - |
- (3934930) | 3934930..3935010 | - | 81 | NuclAT_13 | - | - |
- (3934930) | 3934930..3935010 | - | 81 | NuclAT_13 | - | - |
M5T24_RS19055 (3935606) | 3935606..3936064 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
M5T24_RS19060 (3936325) | 3936325..3937782 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
M5T24_RS19065 (3937839) | 3937839..3938360 | - | 522 | Protein_3734 | peptide chain release factor H | - |
M5T24_RS19070 (3938356) | 3938356..3938562 | - | 207 | Protein_3735 | RtcB family protein | - |
M5T24_RS19075 (3938880) | 3938880..3939332 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
M5T24_RS19080 (3939342) | 3939342..3939740 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
M5T24_RS19085 (3939743) | 3939743..3940036 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
M5T24_RS19090 (3940088) | 3940088..3941143 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
M5T24_RS19095 (3941214) | 3941214..3941999 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
M5T24_RS19100 (3941971) | 3941971..3943683 | + | 1713 | Protein_3741 | flagellar biosynthesis protein FlhA | - |
M5T24_RS19105 (3943907) | 3943907..3944404 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T255341 WP_001263489.1 NZ_CP103529:c3939740-3939342 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |