Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 19011..19657 Replicon plasmid pMB9272_3
Accession NZ_CP103524
Organism Escherichia coli strain 2779 - blood draw same patient as MB9267

Toxin (Protein)


Gene name higB Uniprot ID A0A3P1YQM6
Locus tag M5S63_RS25845 Protein ID WP_025667955.1
Coordinates 19011..19358 (+) Length 116 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A1V3UZT0
Locus tag M5S63_RS25850 Protein ID WP_001259436.1
Coordinates 19358..19657 (+) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S63_RS25815 (M5S63_25815) 14503..14781 + 279 WP_032152803.1 hypothetical protein -
M5S63_RS25820 (M5S63_25820) 14791..15831 + 1041 WP_251296402.1 phage tail protein -
M5S63_RS25825 (M5S63_25825) 15833..16360 + 528 WP_032152674.1 tail fiber assembly protein -
M5S63_RS25830 (M5S63_25830) 16568..17548 + 981 WP_241336524.1 plasmid replication initiator RepA -
M5S63_RS25835 (M5S63_25835) 18192..18479 + 288 WP_032152672.1 hypothetical protein -
M5S63_RS25840 (M5S63_25840) 18503..18766 + 264 WP_000424604.1 hypothetical protein -
M5S63_RS25845 (M5S63_25845) 19011..19358 + 348 WP_025667955.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M5S63_RS25850 (M5S63_25850) 19358..19657 + 300 WP_001259436.1 XRE family transcriptional regulator Antitoxin
M5S63_RS25855 (M5S63_25855) 19822..20202 + 381 WP_000061763.1 hypothetical protein -
M5S63_RS25860 (M5S63_25860) 20266..20538 + 273 WP_000148349.1 helix-turn-helix domain-containing protein -
M5S63_RS25865 (M5S63_25865) 21149..21337 + 189 WP_004105254.1 hypothetical protein -
M5S63_RS25870 (M5S63_25870) 21348..22529 - 1182 WP_116290193.1 ORF6N domain-containing protein -
M5S63_RS25875 (M5S63_25875) 22526..22771 - 246 WP_250143293.1 hypothetical protein -
M5S63_RS25880 (M5S63_25880) 22748..22987 - 240 Protein_29 ash family protein -
M5S63_RS25885 (M5S63_25885) 23848..24096 - 249 WP_000730008.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..48945 48945


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-105)

Antitoxin

Cro/C1-type helix-turn-helix domain

(32-80)


Sequences

Toxin        


Download         Length: 116 a.a.        Molecular weight: 13530.50 Da        Isoelectric Point: 9.3634

>T255324 WP_025667955.1 NZ_CP103524:19011-19358 [Escherichia coli]
MWTVLFSQRFDDWLNEQEDALQEKVLADLKNLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYKKLVRIAEDEFAAHLNTLESK

Download         Length: 348 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 11074.92 Da        Isoelectric Point: 5.2090

>AT255324 WP_001259436.1 NZ_CP103524:19358-19657 [Escherichia coli]
MRTLDEVIASRSPESQARIKEMADEMILEVGLQMMREELQLSQKQVAEAMGISQPAVTKLEQRGNDLKLATLKRYVEAMG
GKLSLDVELPTGKRIAFNI

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3P1YQM6

Antitoxin

Source ID Structure
AlphaFold DB A0A1V3UZT0

References