Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 19011..19657 | Replicon | plasmid pMB9272_3 |
| Accession | NZ_CP103524 | ||
| Organism | Escherichia coli strain 2779 - blood draw same patient as MB9267 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3P1YQM6 |
| Locus tag | M5S63_RS25845 | Protein ID | WP_025667955.1 |
| Coordinates | 19011..19358 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1V3UZT0 |
| Locus tag | M5S63_RS25850 | Protein ID | WP_001259436.1 |
| Coordinates | 19358..19657 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S63_RS25815 (M5S63_25815) | 14503..14781 | + | 279 | WP_032152803.1 | hypothetical protein | - |
| M5S63_RS25820 (M5S63_25820) | 14791..15831 | + | 1041 | WP_251296402.1 | phage tail protein | - |
| M5S63_RS25825 (M5S63_25825) | 15833..16360 | + | 528 | WP_032152674.1 | tail fiber assembly protein | - |
| M5S63_RS25830 (M5S63_25830) | 16568..17548 | + | 981 | WP_241336524.1 | plasmid replication initiator RepA | - |
| M5S63_RS25835 (M5S63_25835) | 18192..18479 | + | 288 | WP_032152672.1 | hypothetical protein | - |
| M5S63_RS25840 (M5S63_25840) | 18503..18766 | + | 264 | WP_000424604.1 | hypothetical protein | - |
| M5S63_RS25845 (M5S63_25845) | 19011..19358 | + | 348 | WP_025667955.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5S63_RS25850 (M5S63_25850) | 19358..19657 | + | 300 | WP_001259436.1 | XRE family transcriptional regulator | Antitoxin |
| M5S63_RS25855 (M5S63_25855) | 19822..20202 | + | 381 | WP_000061763.1 | hypothetical protein | - |
| M5S63_RS25860 (M5S63_25860) | 20266..20538 | + | 273 | WP_000148349.1 | helix-turn-helix domain-containing protein | - |
| M5S63_RS25865 (M5S63_25865) | 21149..21337 | + | 189 | WP_004105254.1 | hypothetical protein | - |
| M5S63_RS25870 (M5S63_25870) | 21348..22529 | - | 1182 | WP_116290193.1 | ORF6N domain-containing protein | - |
| M5S63_RS25875 (M5S63_25875) | 22526..22771 | - | 246 | WP_250143293.1 | hypothetical protein | - |
| M5S63_RS25880 (M5S63_25880) | 22748..22987 | - | 240 | Protein_29 | ash family protein | - |
| M5S63_RS25885 (M5S63_25885) | 23848..24096 | - | 249 | WP_000730008.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..48945 | 48945 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13530.50 Da Isoelectric Point: 9.3634
>T255324 WP_025667955.1 NZ_CP103524:19011-19358 [Escherichia coli]
MWTVLFSQRFDDWLNEQEDALQEKVLADLKNLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYKKLVRIAEDEFAAHLNTLESK
MWTVLFSQRFDDWLNEQEDALQEKVLADLKNLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYKKLVRIAEDEFAAHLNTLESK
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3P1YQM6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1V3UZT0 |