Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 21785..22024 Replicon plasmid pMB9272_2
Accession NZ_CP103523
Organism Escherichia coli strain 2779 - blood draw same patient as MB9267

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag M5S63_RS25365 Protein ID WP_023144756.1
Coordinates 21890..22024 (+) Length 45 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 21785..21845 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S63_RS25340 (16839) 16839..19295 + 2457 Protein_20 AAA family ATPase -
M5S63_RS25345 (19315) 19315..20061 + 747 WP_000205718.1 conjugal transfer pilus acetylase TraX -
M5S63_RS25350 (20116) 20116..20676 + 561 WP_000139341.1 fertility inhibition protein FinO -
M5S63_RS25355 (20807) 20807..21019 + 213 WP_013023861.1 hypothetical protein -
M5S63_RS25360 (21532) 21532..21818 + 287 Protein_24 DUF2726 domain-containing protein -
- (21785) 21785..21845 - 61 NuclAT_0 - Antitoxin
- (21785) 21785..21845 - 61 NuclAT_0 - Antitoxin
- (21785) 21785..21845 - 61 NuclAT_0 - Antitoxin
- (21785) 21785..21845 - 61 NuclAT_0 - Antitoxin
M5S63_RS25365 (21890) 21890..22024 + 135 WP_023144756.1 Hok/Gef family protein Toxin
M5S63_RS25370 (22321) 22321..22575 + 255 WP_000083850.1 replication regulatory protein RepA -
M5S63_RS25375 (22735) 22735..23481 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
M5S63_RS25380 (23496) 23496..25037 - 1542 WP_002431311.1 IS21-like element ISEc12 family transposase -
M5S63_RS25385 (25268) 25268..25399 + 132 Protein_29 protein CopA/IncA -
M5S63_RS25390 (25399) 25399..25473 + 75 WP_031943482.1 RepA leader peptide Tap -
M5S63_RS25395 (25466) 25466..26323 + 858 WP_000130640.1 incFII family plasmid replication initiator RepA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / blaTEM-1B / sul1 / qacE / aadA5 / tet(B) - 1..82867 82867


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T255318 WP_023144756.1 NZ_CP103523:21890-22024 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT255318 NZ_CP103523:c21845-21785 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References