Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 25893..26157 Replicon plasmid pMB9272_1
Accession NZ_CP103522
Organism Escherichia coli strain 2779 - blood draw same patient as MB9267

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag M5S63_RS24885 Protein ID WP_001331364.1
Coordinates 26005..26157 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 25893..25950 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S63_RS24870 (21935) 21935..23005 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
M5S63_RS24875 (23024) 23024..24232 - 1209 WP_048257178.1 IncI1-type conjugal transfer protein TrbA -
M5S63_RS24880 (24450) 24450..25403 - 954 WP_021513958.1 hypothetical protein -
- (25597) 25597..25652 - 56 NuclAT_1 - -
- (25597) 25597..25652 - 56 NuclAT_1 - -
- (25597) 25597..25652 - 56 NuclAT_1 - -
- (25597) 25597..25652 - 56 NuclAT_1 - -
- (25893) 25893..25950 - 58 NuclAT_0 - Antitoxin
- (25893) 25893..25950 - 58 NuclAT_0 - Antitoxin
- (25893) 25893..25950 - 58 NuclAT_0 - Antitoxin
- (25893) 25893..25950 - 58 NuclAT_0 - Antitoxin
M5S63_RS24885 (26005) 26005..26157 + 153 WP_001331364.1 Hok/Gef family protein Toxin
M5S63_RS24890 (26229) 26229..26480 - 252 WP_001291964.1 hypothetical protein -
M5S63_RS24895 (26842) 26842..27074 + 233 Protein_29 hypothetical protein -
M5S63_RS24900 (27139) 27139..27315 - 177 WP_001054898.1 hypothetical protein -
M5S63_RS24905 (27707) 27707..27916 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
M5S63_RS24910 (27988) 27988..28638 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
M5S63_RS24915 (28712) 28712..30880 - 2169 WP_000698357.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..90425 90425


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T255314 WP_001331364.1 NZ_CP103522:26005-26157 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT255314 NZ_CP103522:c25950-25893 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References