Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4910324..4910926 | Replicon | chromosome |
| Accession | NZ_CP103521 | ||
| Organism | Escherichia coli strain 2779 - blood draw same patient as MB9267 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | M5S63_RS23770 | Protein ID | WP_000897305.1 |
| Coordinates | 4910615..4910926 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M5S63_RS23765 | Protein ID | WP_000356395.1 |
| Coordinates | 4910324..4910614 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S63_RS23730 (4905947) | 4905947..4906849 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| M5S63_RS23735 (4906846) | 4906846..4907481 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M5S63_RS23740 (4907478) | 4907478..4908407 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| M5S63_RS23745 (4908589) | 4908589..4908831 | - | 243 | WP_021523315.1 | hypothetical protein | - |
| M5S63_RS23750 (4909050) | 4909050..4909268 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| M5S63_RS23755 (4909687) | 4909687..4909965 | - | 279 | WP_001306650.1 | hypothetical protein | - |
| M5S63_RS23760 (4910027) | 4910027..4910239 | - | 213 | WP_000197769.1 | hypothetical protein | - |
| M5S63_RS23765 (4910324) | 4910324..4910614 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| M5S63_RS23770 (4910615) | 4910615..4910926 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| M5S63_RS23775 (4911155) | 4911155..4912063 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
| M5S63_RS23780 (4912232) | 4912232..4913146 | - | 915 | WP_077634137.1 | transposase | - |
| M5S63_RS23785 (4913159) | 4913159..4914046 | - | 888 | Protein_4649 | hypothetical protein | - |
| M5S63_RS23790 (4914462) | 4914462..4915403 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| M5S63_RS23795 (4915448) | 4915448..4915885 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T255313 WP_000897305.1 NZ_CP103521:c4910926-4910615 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|